KEGG   Micromonospora aurantiaca: Micau_0484Help
Entry
Micau_0484        CDS       T01296                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mau  Micromonospora aurantiaca
Pathway
mau03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mau00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Micau_0484
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mau03400]
    Micau_0484
Enzymes [BR:mau01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Micau_0484
DNA repair and recombination proteins [BR:mau03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Micau_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 mRNA_cap_enzyme RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ADL44051
UniProt: D9T7L9
LinkDB All DBs
Position
493028..493987
Genome map
AA seq 319 aa AA seqDB search
MRNYSQEVPGAPLKPMLATTGQLPAGAAWSYEFKWDGVRALADISRGDRHFYARSGVEIT
TAYPELLNLAEQVGDALLDGEVVLFTDGQPSFTALAERMHVRNPAKAARLAATVPVTYMI
FDLLRLDGVDLTARPWRERRAALESLGLGAARWAVPPVFGDGPATYAAAGEHGLEGVMAK
RVDSLYRPGVRSLDWVKVKLEVTADFVVGGWRPGARRVGGLLVGVPGPDGRLVYRGRVGG
GIGAALERELLRELEPLRSTDSPFAAGVPREDARGAIWVTPRIVVEVKYGQRTPDGRLRF
PRILRLRPDKPPEEVDDAL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaactacagtcaggaggtgcccggcgcgccgttgaagccgatgctcgcgacgacc
gggcagctcccggccggcgccgcctggtcgtacgagttcaaatgggacggcgtccgcgcg
ctcgccgacatctcgcgcggcgacaggcacttctacgcccgctccggcgtcgagatcacc
accgcgtacccggaactgctcaacctggccgagcaggtcggcgacgcgctgctcgacggc
gaggtcgtcctcttcaccgacgggcagccctcgttcaccgcgctcgccgagcggatgcac
gtccgcaacccggccaaggcggcgcggctggcggcgacagtacccgtcacgtacatgatc
ttcgacctgttgcggctcgacggcgtcgacctgaccgcccggccgtggcgggagcggcgg
gcggcgctggagtcgctcgggctcggcgccgcccggtgggcggtgccgccggtcttcggc
gacggcccggccacctacgcggcggccggcgagcacgggctggaaggggtgatggccaag
cgggtcgactcgctctaccggcccggcgtgcgctcgctggactgggtgaaggtcaagctg
gaggtcaccgccgacttcgtggtcggcggctggcggcccggcgcgcggcgcgtcggtggc
ctgctggtcggcgtgcccggcccggacggacggctggtctaccgggggcgggtcggcggc
gggatcggcgcggcgctcgaacgggaactgctgcgcgagctggaaccactgcgctccacc
gactcgccgttcgccgccggcgtgccgcgcgaggatgcccggggcgcgatctgggtaact
ccccggatcgtggtggaggtcaagtacggccagcgcacgccggacggccggctgcgcttc
ccgcgcatcctgcgcctgcgcccggacaagccgcccgaggaggtcgacgatgccctctga

DBGET integrated database retrieval system