KEGG   Micromonospora aurantiaca: Micau_1646Help
Entry
Micau_1646        CDS       T01296                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
mau  Micromonospora aurantiaca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ADL45201
UniProt: D9SZR9
LinkDB All DBs
Position
complement(1718592..1719704)
Genome map
AA seq 370 aa AA seqDB search
MDLPINPPVEPMLAKSVAELPTDAGLTYEPKWDGFRCIVFRDGDEVELASRGGKSMTRYF
PEVVEQARRQLPARCAVDGELIVIRRDGPGGQPRLDFELLAQRIHPAASRVKLLAETTPA
DFVAFDLLAIDDELLVDQPYPRRRERLEQALSGVRPPVHVTQVTTDPETARRWFDVFEGA
GLDGLIVKPADLPYEPGKRLMFKVKHARTMDAVVAGFRWHKSGPVIGSLLLGLYDDDGVL
HHIGVSSSFTMARRKELLDELEPYRDVGGEHPWVHGDHERGQRIPGGVSRWTGGKNLEWE
PLRPALVVEVAYDAMEGDRLRHTARFLRWRPDRDPRSCDYGQLDRPIRYDVDEVLRGDPA
ATVGDTRGRA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgccgatcaaccctccggtcgagccgatgctcgccaagagcgtcgccgagctg
cccaccgatgccggtctgacctacgagccgaagtgggacggcttccgctgcatcgtgttc
cgcgacggcgacgaggtcgagctggccagccggggcggcaagtcgatgacgcgctacttc
cccgaggtggtcgagcaggcccgccggcagctcccggcccggtgcgcggtcgacggcgag
ctgatcgtgatccgccgggacggcccgggtgggcagcctcggctcgacttcgagctgctg
gcccagcggatccatccggccgcctcccgggtgaagctgctggccgagaccaccccggcc
gacttcgtcgcgttcgacctgctggcgatcgacgacgagctgctcgtcgaccagccctat
ccccggcggcgggagcggctggagcaggcgctgtccggggtacgcccgccggtgcacgtg
acgcaggtgaccaccgacccggagacggcccgccgctggttcgacgtgttcgagggcgcc
gggctggacgggctgatcgtcaagccggccgacctgccgtacgagccgggcaagcggctc
atgttcaaggtcaagcacgcccgcacgatggacgcggtggtggccggtttccgttggcac
aagtccggtccggtgatcggctcgctgctgctcggcctctacgacgacgacggcgtgctg
caccacatcggcgtcagctcctcgttcaccatggcccgccgcaaggagctgctcgacgag
ctggagccctaccgcgacgtcggcggtgagcacccgtgggtgcacggcgaccacgagcgg
ggccagcgcatcccgggcggggtgagccggtggaccggcggcaagaacctggagtgggag
ccgctgcgtccggcactggtggtcgaggtggcgtacgacgcgatggagggcgaccggctg
cggcacaccgcccggttcctgcgctggcgacccgaccgtgatccccgctcctgcgactac
ggtcagctcgaccgcccgatccgttacgacgtcgacgaggtgctgcgcggcgatccggca
gcgacggtcggtgacacccgcggccgggcgtag

DBGET integrated database retrieval system