KEGG   Micromonospora aurantiaca: Micau_2469Help
Entry
Micau_2469        CDS       T01296                                 

Definition
(GenBank) Acyl transferase
Organism
mau  Micromonospora aurantiaca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR PS-DH Ketoacyl-synt_C KAsynt_C_assoc PP-binding adh_short Docking Thiolase_N Epimerase Polysacc_synt_2 GDP_Man_Dehyd SAT NmrA
Motif
Other DBs
NCBI-ProteinID: ADL46009
UniProt: D9T6W9
LinkDB All DBs
Position
2775039..2785988
Genome map
AA seq 3649 aa AA seqDB search
MADEAKLLDYLKRVTADLHQVRQRLREVEAGEQEPVAIVSMSCRFPGGVRSPEDLWEVVA
SGRDVVSDFPTDRGWDVASLYDSDPEQAGTSYTRQGGFVHDLADFDPGFFAISPREALAM
DPQQRWLLETSWEALERAGIDPHSLRGSRTGVFAGSTGQDYGTVLMGAAQGLEGHLMTGN
AGSVVSGRIAYTFGLEGPAVTIDTACSSSLVALHLAGQALRQQECTLAIVAGVTAMCTPA
AFVEFSRQRGLAADGRCKAFAAAADGTGWSEGVGVLVLERLSDAQRNGHPILAVVRGSAV
NQDGASNGLSAPNGPSQQRVIQQALANAGLAAGGVDVVEAHGTGTRLGDPIEAQALLATY
GQERGDSAPLLLGSVKSNIGHAQAAAGVAGVIKMVMAMRHGVVPPTLHVDEPTPEVDWSA
GDVSLVTEATPWPAVDRPRRSAVSSFGVSGTNAHTILEQAPAPQPAPSAAVPVVERPVVP
VPLSARDAAGLAAQAARWAARIAADETLRPLDVAFSSVTSRSTLDHRAVVHATGREDLLA
GLRALAAGQPSGAVVAGQAGGRGSVAVLFSGQGAQRAGMGRELYAGFPVFAATLDEVCVY
LDALLPRPLREVLFALEGSAEAALLDQTVFTQAGLFAVEVALFRLVESFGIAPEFVGGHS
IGEVTAAYVAGVLSLADACALVAARGRLMQALPAGGGMLAVAADEVAVVESIAGSTDRVG
IAAVNGPTSVVVSGAVDALDEVERVWRDRGVRTRRLTVSHAFHSPLMEPMLAEFRAVLDG
LTFSAPSLPVVSNVTGALADADEIRTADYWVRHVREAVRFADGVTALCEAGVDTFLEVGP
QSVLTAMVGEILPGDDVVLAAAAQRKDRSGAHGLLAGLAELHVHGVAVDWLQWFADTGAR
RVDLPTYAFQHQRYWPEAGAGWTGDVTAVGLRPAQHPLLGAAVGVAHAEGFLFTGRLARR
THPWICDHVVFDTVLLPGTGFVELALQAGGHVGADHVRELTLESPLILPETGGVDIQLWI
GPADETGCRSVSLHSAQDGEPAEGTGERAWTRNASGVLASGPAVPSGPAGWSDLTTWPPP
GATEVGTDDLYLNLAAQGYDYGPSFIALRSAWRRGDDLFAELALPEAPAAEAAGYGLHPA
LLDAALHTLGLTTPAGEPSGAGMPPGFGRLPFSWNDVALHGAGAAAARVRVSHTGPDSIS
LLLTDVTGAPVISVGSLVLRPVSADQLRTASGGGTESLFRVEWAPLVLPAGPSTVDWAVL
GDAAALTDAVAATGTAVAAYPDLAALATAMDGGTDAPGVLVLPLLDPPASADVPRAVAEA
THRVLAVLQQFLAEERYAVSRLVVLTSGAVATDRDTDLTDLAGAAVIGLLRSAQSENPDR
FVLVDVDDVAGCAAALVPAVATDEPQVVIRAGVAAGARLTRVPAPTEPPAAPFDSDGTVL
ITGATGTLGRLMSRHLVSTYGVRHLILTSRRGRAAGGVAELCAELEALGVSVTVAACDVA
DRGAVAELLAGIPAEHPLTAVIHAAGVRDDGVISSLTPERMDGVLRPKVDAAWHLHELTA
DLDLKAFVSYSSLAATAGGPGQGNYAAANAFLDGLAQHRKARGLAALTLAWGLWADRSGM
TTELDDVHLNRISRSGVAAMEAEEGLALFDAACRTTDAALVPARLDLAAMKVQFAGGSIP
PLYRALIRTPARAAAASTGASLVQQLAGLGDAERAAALVEIVRGQAAAVLGYPDPAAIEP
RRAFSEFGFDSLTAVEMRNRLNNAFGMRLPATLVFDYPTPHDLAAFLGTEIAGTPVPMRP
TTTAVSVGDDEPLAIIGMACRLPGGVWSPDDLWRLVVDGVDAISDLPTDRGWDLDSLYSP
DPDAPGTFYARGGGFLSGVDRFDPNFFGISPREALAMDPQQRLLLETTWESFESAGIDPT
DVRGSSTGVFVGTSGQDYGSLLAYSPEAAEGYMLTGMTSSVISGRVAYTFGLEGPAVSLD
TACSSSLVALHWAGQALRRGECDMALAGGVMVMATPTAFVEFSRQRGLAADGRCKSFAAS
ADGTGWSEGVGMLLVQRLSDARRQGRTVYAVVRGSAINSDGASNGLTAPNGPSQQRVIRQ
ALASARLTTADVDVVEAHGTGTTLGDPIEAQALLATYGRERPADRPLLLGSIKSNIGHAQ
AAAGVAGVIKMVQAIRHGLVPATLHVDEPSPHIDWTSGAVELATQSRPWPAVDRPRRAAV
SSFGISGTNAHVIIEQADELSVAPAEPSPGLVASDAVLWPLSGRSKGALAGQAARLAEYV
RERGDIDAAAVGWSLATTRSAFGHRAAVVGSGTEELLAGLDAVVSGTPAGNVVADTTTSH
GAGPVFVFPGQGAQSARMAAGLVGRAPVFDARLAECQRALAPYLDVDLVSVLTGEDESWL
ERVEVVQPVLWAVGVALAAVWRHAGVVPAAVIGHSQGEIGAACVAGILSLEDAAKAVALR
SRALTVLRGTGTMASVDLSAESVAERLGEFPGVGVAAVNGPSTVVVSGPPRPVADLVEAC
QADGVRARLIPVDYASHSAAVQDVAEQLRADLADVTPQPGHTRLVSTLTGDWVDPSSMTA
DYWYDNLRQTVQFEAAVRVAVEAGHTTFVEISPHPVLAMPVTAILDDAGVSGHTLGSLRR
GDDDATRLLTNLATAHTIGLPVDLTAVLAETDTVALPTYAFDHQRYWVEPPVHRAQDVAS
AGLQDAGHPLLSAALTFPDSERMVFTGRLSVRTHPWLGEHRVMDNILLPGTAFVELATYA
GEQAGCPTVEELTLLAPLVLPELGALQVQLTVGDRDDDGRRTVQLYSRPYRDGSDEILAD
VAWTCHATGLLGPQPADAAPAFDLGVWPPPGATRVESDDFYSGIEATVFGYGPAFRGLRA
AWTRDDEVFAEVELPADHHATAGRFGVHPALLDGALQAMSIGGFLGRMGDGADASVPRLP
FAWTGVSLLAAGATALRVRVAAAGEVGVSFQVADATGAPVLHVDSLIMRRVSGDSLGAAR
SGRHESLFQVDWPVLPVPTGPVPAATRWVALGDDLALSAACEAAGARVRTDVGLDSLGDL
LAGGEPTPEAVIVPVGDAGDPTDPELAAQARATTHRTLAALRTWLADDRFADSRLVLVTR
NAVAAGEQEPVNLRQAPVWGLLRTAQLEHPGRCQLVDLDDAPDSAAAVAAAIASGEPQLA
VRDGQVRTPRLGRVPAAVEPLPGGIDPAGTVLITGGTGVLGRILARHLATSHGVRHLLLA
GRRGAAAEGIGDLVTELAGTGTEVAVVACDAADPEALSALLAGVPAAHPLTAVVHAAGVL
DDGVLESMTPDRVDAVAVPKIDAAWHLHRLTADANLAAFVLFSSAAATLGSAGQSNYAAS
NAFLDALAAHRRARGLAGNSLAWGLWEQASGMTGHLGDDDVRRMAEQGATGLATEQALNL
FDAAWRLDAAAVLPMRLDVGTLRGQAEGGTLAPILRALVRVPLRRSVDATGARSGGVQLG
QRLAGLAAPERLKVVLDVVRANIAAVLGHAGPDAVDPNRLFTDLGFDSLTAVDLRNRLNN
LSGLRLPATLVFDYPTPTALAEKLTSEIAADAAPSTQPLFQGIDTVESLLTAIPLDPAAR
ARFTARMQDLLAKASDLAAGPSVEPDRPDLDSASDDEIFDFISKEFGIS
NT seq 10950 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgaggcgaagcttctcgactacctcaagcgggtcaccgctgacctgcaccag
gtgcgccagcgcctgcgcgaggtggaagccggtgaacaggaaccggtcgccatcgtctcc
atgagctgccgcttcccgggcggggtgcgctcgcccgaggacctgtgggaggtggtcgcg
tccggccgggacgtggtctccgacttcccgaccgaccgcggctgggacgtcgcgtcgctc
tacgacagcgaccccgagcaggccggcacgtcgtacacgcggcagggtggcttcgtccac
gacctggccgacttcgacccggggttcttcgcgatctccccccgggaggcgctggcgatg
gacccgcagcagcgctggctgctggagacctcgtgggaggccctggagcgggccggcatc
gacccgcactcgctgcgcggcagccgcaccggcgtcttcgccggtagcaccggccaggac
tacggcaccgtgctgatgggtgccgcgcagggcctggaggggcacctgatgaccggcaac
gccggcagcgtggtgtccggccggatcgcctacaccttcgggttggaggggccggccgtc
accatcgacaccgcctgctcgtcctccctggtcgccctgcacctcgcgggccaggcgctg
cggcagcaggagtgcaccctggccatcgtcgccggcgtcaccgccatgtgcaccccggcc
gccttcgtcgagttctcccggcagcgcggcctcgccgccgacggccggtgcaaggcgttc
gccgccgccgccgacgggaccggctggtccgagggcgtcggcgtcctggtgctggaacgg
ctctcggacgcgcagcgcaacggccaccccatcctcgccgtggtacggggcagcgcggtg
aaccaggacggcgcctccaacgggctgagcgccccgaacgggccgtcgcagcagcgggtg
atccagcaggccctggccaacgccggcctcgccgccggcggcgtggacgtggtggaggcg
cacggcaccggcacccgtctcggcgacccgatcgaggcgcaggcgctgctggccacgtac
gggcaggagcggggggactccgcgccgctgctgctcggctcggtcaagtcgaacatcggc
cacgcgcaggcggccgccggggtggccggcgtcatcaagatggtcatggcgatgcggcac
ggcgtcgtaccgcccaccctgcacgtcgacgagccgacgcccgaggtcgactggtcagcc
ggcgacgtctcgctggtgaccgaggcgacgccgtggccggcggtggaccggccgcgccgc
tcggcggtctcctcgttcggggtgtccggcaccaacgcgcacaccatcctggagcaggcc
ccggcaccgcagccggccccgtcggccgccgtgccggtggtcgagcggccggtcgtaccg
gtgccgctgtcggcccgggacgctgccggcctcgccgcgcaggcggcccgctgggcggcc
cggatcgccgccgacgagaccctgcgccccctggatgtggccttctcgtcggtcacctcc
cggtccaccctggaccaccgcgccgtggtccacgcgaccggccgcgaggacctgctggcc
gggctgcgcgccctcgccgccggtcagccgtccggcgcggtcgtcgccgggcaggccggc
ggccggggctcggtcgcggtgctcttctccggccagggcgcgcagcgcgccggcatgggc
cgggagttgtacgcgggcttcccggtgttcgccgccacgctggacgaggtgtgcgtgtac
ctggacgcgctgctgccgcgtccgctgcgggaggtgctgttcgcgctggagggttccgcc
gaggcggccctgctggaccagacggtgttcacgcaggcgggcctgttcgccgtcgaggtg
gcgctgttccgcctcgtcgagtcgttcggcatcgcgccggagttcgtgggcggtcactcg
atcggtgaggtgacggccgcgtacgtggcgggcgtgctgtcgctggccgacgcgtgtgcg
ctggtggcggcgcggggccggttgatgcaggccctgccggccggtggcggcatgctcgcg
gtggccgccgacgaggtggcggtggtcgagtcgatcgccggctcgaccgaccgggtcggg
atcgcggccgtcaacgggccgacctcggtcgtggtctccggtgccgtcgacgccctcgac
gaggtggagcgggtctggcgggaccggggcgtgcgtacgcgccggctgaccgtcagtcac
gcgttccacagtccgctgatggagccgatgctcgccgagttccgcgccgtcctcgacggg
ttgacgttctccgcgccgtcgctgccggtggtgtcgaacgtgaccggtgcgctggccgac
gccgacgagatccgcaccgccgactactgggtgcgccacgtccgcgaggccgtccgcttc
gccgacggggtcaccgccctgtgcgaggcgggggtggacacgttcctggaggtcgggccg
cagagcgtcctgaccgcgatggtcggcgagatcctgccgggcgacgacgtcgtgctggcc
gccgccgcgcagcgcaaggaccggtccggggcgcacgggctgctggccgggttggccgag
ctgcacgtgcacggcgttgcggtcgactggctgcagtggttcgccgacaccggcgcccgg
cgggtcgacctgcccacgtacgccttccagcaccagcgctactggcccgaggcgggcgcc
gggtggaccggcgacgtcaccgcggtcggcctgcgccccgcgcaacaccccctgctcgga
gccgccgtcggcgtcgcgcacgccgagggcttcctcttcaccggccggctggcccggcgt
acccacccgtggatctgcgaccacgtcgtcttcgacaccgtgctgctgcccggcacgggt
ttcgtcgaactcgccctccaggcgggtgggcacgtcggcgcggaccacgtccgcgaactc
accctggagtcgccgctgatcctgccggagaccgggggcgtcgacatccagctctggatc
ggcccggcggacgagaccggctgccgttccgtgtcgctgcactccgcgcaggacggcgag
ccggccgagggcacgggtgagcgggcctggacccgcaacgccagcggcgtgctggccagc
ggcccggccgtgccgagcggtcccgccggctggtccgacctgaccacctggccgccgccg
ggcgcgaccgaggtcggcaccgacgacctctacctgaacctcgccgcccagggctacgac
tacggcccgtcgttcatcgccctgcgctccgcctggcggcgcggcgacgacctcttcgcc
gagctggcgctgcccgaggcccccgccgccgaggccgccgggtacggcctgcacccggcc
ctgctcgacgcggcgctgcacaccctcggcctgaccacgccggccggggagccctccggg
gcgggcatgccccccggattcggccgcctgccgttctcctggaacgacgtcgccctgcac
ggcgccggggccgcggcggcccgcgtccgggtctcgcacaccggccccgacagcatctcg
ctgctgctcaccgacgtcaccggcgcgccggtcatctccgtcggctccctcgtcctgcgg
ccggtctccgccgaccagctccgcaccgcctccggcggcggcaccgagtcgctgttccgg
gtcgagtgggccccgctcgtgcttcccgccggcccgtccacggtcgactgggcggtgctc
ggcgacgccgcggcgctcaccgacgcggtcgccgccaccggcacggccgtggcggcgtac
cccgacctggcggccctggccacggcgatggacggcgggacggacgcgcccggcgtgctg
gtcctgccgttgctcgacccgcccgcgtcggcggacgtgccgcgcgccgtcgccgaggcg
acccaccgggtgctcgccgtgctccagcagttcctcgccgaggagcgctacgcggtgtcc
cgactggtggtgctgacctcgggcgcggtcgccaccgaccgggacaccgacctgacggac
ctggccggcgccgccgtgatcggcctgctgcgctccgcccagtcggagaaccccgaccgg
ttcgtgctggtggacgtcgacgacgtggccggctgcgccgccgcgctcgtcccggccgtc
gcgaccgacgagccgcaggtcgtgatccgcgcgggcgtcgccgccggcgcccggctcacc
cgggtccccgccccgaccgagccgccggcagccccgttcgactccgacggcaccgtcctg
atcaccggcgccaccggcaccctcggccggctgatgagccggcacctggtcagcacgtac
ggcgtccggcacctgatcctcaccagccggcgcggtcgcgccgccgggggcgtcgcggag
ctctgcgccgagttggaggcgctcggcgtgagcgtcaccgtcgccgcctgcgacgtcgcc
gaccgtggcgccgtggccgagctgctggccggcatcccggcggagcacccgctgaccgcc
gtcatccacgccgccggcgtccgcgacgacggcgtcatctcctcgctcacccccgagcgg
atggacggcgtgctgcggcccaaggtcgacgccgcctggcacctgcacgagctgaccgcc
gacctcgacctgaaggcgttcgtctcgtactcctcgctggccgccaccgccggcggcccg
ggccagggcaactacgccgccgccaacgcgttcctcgacgggctggcccagcaccgcaag
gcgcgcggcctcgccgccctcaccctcgcctggggcctctgggccgaccgcagcggcatg
accaccgagctggacgacgtccacctcaaccggatctcccgctccggcgtcgccgccatg
gaggccgaggaggggctcgccctcttcgacgcggcctgccgcaccaccgacgccgcgctc
gtcccggcccggctggacctcgccgcgatgaaggtgcagttcgccggcggaagcatcccg
ccgctgtaccgggcgctgatccgcacgcccgcccgcgccgccgcggccagcaccggcgcg
tcgctggtgcagcagctcgccgggctcggcgacgccgagcgggccgccgcgctggtcgag
atcgtccggggccaggccgccgccgtgctcggctaccccgacccggcggccatcgagccg
cgccgggcgttcagcgagttcggcttcgactcgctcaccgccgtcgagatgcgcaaccgg
ctcaacaacgcgttcgggatgcggctgccggccaccctcgtcttcgactacccgaccccg
cacgacctggcggccttcctgggtacggagatcgccggcaccccggttcccatgcgaccc
acgacgaccgccgtgtcggtcggcgacgacgagcccctcgcgatcatcggcatggcctgc
cggctgcccggcggcgtgtggtcgcccgacgacctgtggcggctggtggtcgacggcgtg
gacgcgatcagcgacctgcccaccgaccgtggctgggacctcgacagcctctacagcccc
gaccccgacgcccccggcaccttctacgcccgcggcggcggcttcctcagcggcgtcgac
aggttcgaccccaacttcttcggcatctcgccccgcgaggccctggccatggacccgcag
cagcgactgctgctggagaccacctgggagtccttcgagtccgccggcatcgaccccacc
gacgtacggggcagcagcaccggcgtcttcgtcggcaccagcggccaggactacggctcg
ctgctcgcgtactcgccggaggccgccgagggctacatgctgaccgggatgaccagcagc
gtcatctccggccgggtggcgtacacgttcgggctggaggggccggcggtgtcgctggac
acggcctgctcgtcgtcgctggtcgcgctgcactgggccggccaggcgctgcggcgcggc
gagtgcgacatggccctcgccggtggcgtcatggtgatggccaccccgaccgcgttcgtc
gagttctcccggcagcgcggcctggccgccgacggccggtgcaagtcgttcgccgcgtcc
gccgacggcaccggctggtccgagggcgtcggcatgctgctcgtgcagcggctctccgac
gcccgccggcagggccgcaccgtctacgcggtggtgcgcggctcggcgatcaactccgac
ggcgcctccaacgggctgaccgccccgaacggcccctcgcagcagagggtgatccggcag
gcgctggcgtcggcccgcctcaccacggccgacgtggacgtggtcgaggcgcacggcacg
ggcaccaccctcggcgacccgatcgaggcgcaggccctgctcgccacgtacgggcgggag
cggcccgccgaccggcccctgctgctcggctcgatcaagtcgaacatcggccacgcccag
gccgcagccggtgtggccggcgtgatcaagatggtgcaggccatccggcacggcctcgtc
ccggcgacgctgcacgtggacgagccgtcgccgcacatcgactggacctccggcgcggtg
gagctggcgacgcagtcgcggccctggccggcggtggaccggccgcgccgggcggcggtg
tcctcgttcggcatctccggcaccaacgcccacgtcatcatcgagcaggccgacgaactg
tccgtggcaccggccgagcccagccccgggctcgtggcctccgacgcggtgctgtggccg
ctgtcgggacggtcgaagggcgccctggccggccaggcggcccgtctcgcggagtacgtg
cgtgagcgcggcgacatcgacgcggcggcggtgggctggtccctggctacgacccggtcg
gcgttcggtcaccgtgccgctgtcgtcgggtcgggcacggaggagttgctggcggggctg
gacgcggtggtgtccgggacgccggccggcaacgtcgtcgccgacaccaccacgtcccac
ggcgcgggcccggtgttcgtgttcccgggccagggtgcgcagtcggcacgaatggccgcc
ggtctcgtcggtcgtgcgcccgtgttcgacgcgcggctggcggagtgccagcgggctctc
gccccgtacctcgatgtcgatctcgtgtcggtgttgaccggcgaggacgagtcgtggttg
gagcgggtcgaggtggtgcagccggtgctgtgggccgtcggtgtggctctggcggcggtg
tggcggcatgcgggtgtggtgccggcggcggtgatcgggcattcgcagggtgagatcggc
gcggcgtgtgtggcggggatcctgtccctggaggacgcggcgaaggcggtcgcgttgcgg
tcgcgtgcgctgacggtgctgcggggtaccggcacgatggcgtcggtcgacctgtcggcg
gagtcggtggccgagcggctcggggagttccccggggtgggcgtcgcggcggtgaacggt
ccgtccacggtcgtggtgtcgggtccgccgcggccggttgccgacctggtggaggcgtgt
caggccgacggggtgcgggcgcggttgattccggtggattatgcgtcgcattcggcggcg
gtgcaggatgtcgcggagcagttgcgcgccgacctggccgacgtgacgccgcagccgggc
cacacccgactcgtgtcgacgctcaccggggactgggtggacccgtcctcgatgacggcg
gactactggtacgacaatctgcggcagaccgtccagttcgaggccgccgtccgggtggcc
gtcgaggcgggtcacaccacgttcgtggagatctctccgcacccggtgctggcgatgccg
gtcacggcgatcctggacgacgccggcgtgagcgggcacacgctgggcagtctgcgccgc
ggtgacgacgacgcgacgcggctgctgacgaacctcgccaccgcgcacacgatcggtctg
cccgtcgacctgacggccgtactcgccgagaccgacaccgtcgcactgcccacgtacgcc
ttcgaccaccagcggtactgggtcgagccgccggtgcaccgggcgcaggacgtcgcctcc
gccggcctccaggacgccgggcacccgctgctcagcgccgcgctgaccttccccgacagc
gagcggatggtcttcaccgggcggctgtcggtgcgtacccacccgtggctcggcgagcac
cgggtgatggacaacatcctgctgcccggcaccgccttcgtcgaactggccacgtacgcc
ggtgagcaggccggctgcccgacggtggaggagctgaccctgctcgccccgctcgtcctg
cccgaactcggcgcgctccaggtgcagctgacggtcggcgaccgggacgacgacgggcgg
cgtaccgtccagctctactcccggccctaccgggacggctcggacgagatcctcgccgac
gtcgcctggacctgccacgccaccggtctgctcggcccgcagccggccgacgccgcgccc
gccttcgacctaggggtctggccgccgcccggcgcgacacgcgtcgagtccgacgacttc
tactccggtatcgaggcgaccgtcttcggctacggaccggcgttccgtggcctgcgcgcc
gcgtggacccgcgacgacgaggtcttcgccgaggtcgagctgcccgccgaccaccacgcc
acggccggccgcttcggcgtgcacccggcactgctggacggcgcgctgcaggccatgtcg
atcggcggcttcctcggccggatgggcgacggcgccgacgccagcgtgccccgtctgccg
ttcgcctggaccggggtctccctgctcgccgccggggccaccgccctgcgcgtacgcgtc
gccgcggccggcgaggtcggcgtctccttccaggtggccgacgccaccggcgccccggtg
ctgcacgtcgactcgctgatcatgcgccgcgtctccggggactccctcggcgcggcccgc
tccggccggcacgagtcgctgttccaggtggactggccggtgctgccggtgccaaccggc
cccgtgccggcggccacccgctgggtggcgctcggcgacgacctggcgctcagcgccgcc
tgcgaggcggccggtgcccgggtgcgtaccgacgtcgggctcgactcgctgggcgacctg
ctcgccgggggtgagccgacgcccgaggcggtgatcgtcccggtcggcgacgccggggac
ccgacggacccggagctcgccgcacaggcgcgggccaccacgcaccgtacgctcgccgcg
ttgcggacctggctcgccgacgaccggttcgccgactcgcggctggtgctcgtcacccgg
aacgcggtcgcggcaggggagcaggagccggtgaacctgcgccaggcccccgtctggggc
ctgctgcgcaccgcccagctcgaacacccgggccggtgccagctcgtcgacctcgacgac
gccccggacagcgccgccgcggtggccgccgccatcgcctccggcgagccgcagctcgcc
gtgcgcgacgggcaggtccgcacgccacggctcggccgggttccggccgccgtcgaaccg
ctgcccggcgggatcgacccggccggcaccgtgctgatcaccggcggcaccggcgtgctg
ggccgcatcctggcccgccacctcgccaccagccacggcgtacggcacctgctgctggcc
gggcggcgcggcgcggcggccgaggggatcggcgacctggtcaccgaactcgccggcacc
ggtacggaggtggccgtcgtggcctgcgacgccgccgaccccgaggccctgtcggcgctg
ctggccggggtgcctgcggcgcacccgctcaccgccgtggtgcacgccgccggcgtcctc
gacgacggcgtgctggagtcgatgacccccgaccgggtggacgcggtcgccgtgccgaag
atcgacgccgcctggcacctgcaccgcctcacggccgacgcgaacctcgcggccttcgtc
ctgttctcctcggcggcggccacgctgggcagcgccggccagtccaactacgcggcgtcg
aacgccttcctcgacgccctcgcggcgcaccgccgggcacgtgggctcgccggcaactcg
ctcgcctggggcctgtgggagcaggccagcggcatgacgggtcacctcggcgacgacgac
gtgcgacggatggccgagcagggcgccaccggcctggccaccgagcaggcgctgaatctc
ttcgacgccgcgtggcggctcgacgcggcggccgtcctgccgatgcgcctggacgtcggg
acgctgcgcgggcaggcggagggcggcaccctcgcgcccatcctccgggccctggtccgg
gtgccgctgcggcgctccgtggacgccaccggtgcccgctccggcggggtccaactcggc
cagcggctcgccggactggccgccccggagcggctcaaggtggtgctcgacgtggtacgg
gcgaacatcgccgccgtcctcggccacgccggccctgacgcagtcgacccgaaccggctc
ttcaccgacctgggctttgactcactcaccgccgtcgacctgcgcaaccggctcaacaac
ctgtccggcctgcggctgccggcgacgctcgtcttcgactacccgacgccgacggcgctc
gccgagaagctgacaagcgagatcgccgccgacgcggcgccctccacccaaccgctcttc
cagggcatcgacacggtggagagcctgctcaccgccatcccgctcgacccggcggcccgc
gcccggttcaccgcccggatgcaggacctgctcgccaaggcgtccgaccttgcggccggg
ccctccgtcgaaccggaccggccagacctcgactcggccagcgacgacgagatcttcgac
ttcatcagcaaagagtttggaatctcctga

DBGET integrated database retrieval system