KEGG   Micromonospora aurantiaca: Micau_3090Help
Entry
Micau_3090        CDS       T01296                                 

Definition
(GenBank) Gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00430  Taurine and hypotaurine metabolism
mau00460  Cyanoamino acid metabolism
mau00480  Glutathione metabolism
mau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Micau_3090
   00460 Cyanoamino acid metabolism
    Micau_3090
   00480 Glutathione metabolism
    Micau_3090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mau01002]
    Micau_3090
Enzymes [BR:mau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Micau_3090
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Micau_3090
Peptidases [BR:mau01002]
 Threonine Peptidases
  Family T3: gamma-glutamyltransferase family
   Micau_3090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ADL46619
UniProt: D9TCC1
LinkDB All DBs
Position
3494254..3496041
Genome map
AA seq 595 aa AA seqDB search
MAFTTRPTLRGTFGMVSSTHWLASQSAMGVLERGGNAFDAAVAAGFVLHVVEPHLNGPAG
EVPAVLATATDPTPRVLCGQGPAPAAATVAHFRSLGLDLVPGAGPLAAVVPGAVDAWLLL
LRDHGTRTLAEVLEPAIGYAAAGHPLVGPAGQTVARVRSLFTDHWPTSARLWLRDGRPPA
PGEMVTNPAYADTLRRLVDAGRAAGADREAQIEAARLAWREGFVAEAIDAFSRLPFRDSS
GRAHAGLVTGDDLAGWSATWEEPVTLDWHGHTIAKTGFWGQGPVLLQTLSILDALDDPRV
HDPSSLEGIHAQAEALKLAFADREAWYGDTDVPGSALLSAGYARARAALVGDRADTTLRP
GSPAGEPPRLPSHLHTDVGRGAVPQDPSTGEPTVRADGVTRGDTCHVDVVDRWGNIVSAT
PSGGWLQSSPVIPELGFPLGSRLQMCWLEEGLASTLRPGRRPRTTLSPTLVLRDGEPVMA
CGTPGGDQQDQWQLLFLLRHLAGGQELQEAIDAPTWHTTSFPASFYPREVEPGVLVLEDR
IDGDVLAGLRARGHTVRLSDPWSLGRMCAVARDPRTGVLSAAANPRGAQGYATGR
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaccacccggccgacgttgcgcggcacgttcggcatggtctcctccacgcac
tggctggccagccagtccgcgatgggcgtgctggaacgcggcggcaacgccttcgacgcc
gcggtggccgccgggttcgtgctgcacgtcgtggagccgcacctcaacgggccggccggc
gaggtgcccgcggtcctcgccaccgcgaccgaccccaccccgcgggtgctgtgcggtcag
ggcccggcccctgcggccgcgacggtcgcccacttccggtcgctcggcctggacctcgtg
ccgggcgccggtccgctcgccgccgtcgtgccgggcgctgtcgacgcctggctgttgctg
ctgcgcgaccacggcacccgaacgctcgccgaggtgctggaaccggcgatcggctacgcc
gccgcaggccatccgctggtcggcccggccgggcagaccgtcgcgcgggtccgttcgctg
ttcaccgaccactggccgacctccgcgcgcctctggctccgcgacggccgcccgcccgcg
ccgggggagatggtcaccaacccggcgtacgcggacacgctgcgccgcctcgtcgacgcg
ggacgggccgctggtgcggaccgggaggcgcagatcgaggcggcccggctcgcctggcgg
gagggtttcgtcgccgaggcgatcgacgcgttcagccggctgccgttccgcgactccagc
gggcgtgcgcacgccgggctggtcaccggcgacgacctggccggatggtcggccacctgg
gaggaaccggtcacgctggactggcacgggcacacgatcgccaagaccggcttctggggc
cagggcccggtgctgctccagacgctctccattctggacgcgctcgacgacccgcgtgtc
cacgacccgtcgagcctggagggcatccacgcgcaggccgaggcgctgaagctcgcgttc
gccgaccgggaggcgtggtacggcgacaccgacgtgccgggctccgcgctgctgtcggcc
ggctacgcccgtgcgcgggccgcgttggtcggcgaccgtgccgacacgacgctgcgcccc
ggaagcccggcgggcgagccgccccggctcccgtcccacctgcacaccgacgtgggtcgc
ggggccgtcccgcaggatccgagcaccggcgaacccacggtacgggcggacggcgtgacc
cgcggcgacacctgccacgtcgacgtggtggaccggtggggcaacatcgtctctgccacg
cccagcggtggctggctgcagagttcacctgtcatcccggagctgggcttcccgctcggc
agccggttgcagatgtgctggctggaggaggggctcgcctccacgctgcggccggggcgg
cgtccgcgtaccacgctcagcccgacgctcgtgctccgcgacggcgagccggtgatggcc
tgcgggacgcccggcggcgaccagcaggaccagtggcagttgctgttcctgctgcggcac
ctggccggcgggcaggagttgcaggaggcgatcgacgcgccgacgtggcacacgacgagc
ttccccgcgtcgttctatccacgcgaggtcgagccgggcgtgttggtgctggaggaccgg
atcgacggcgacgtgctggcgggcctgcgcgcaaggggccacaccgtccgcttgtccgac
ccgtggagcctgggccgcatgtgcgcggtggcacgcgacccacgcaccggtgtcctctcc
gccgcggcgaacccccgaggcgcccagggctacgccacaggccgctga

DBGET integrated database retrieval system