KEGG   Micromonospora aurantiaca: Micau_3376Help
Entry
Micau_3376        CDS       T01296                                 

Definition
(GenBank) inositol monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00521  Streptomycin biosynthesis
mau00562  Inositol phosphate metabolism
mau01100  Metabolic pathways
mau01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Micau_3376
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Micau_3376
Enzymes [BR:mau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     Micau_3376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P FBPase FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: ADL46904
UniProt: D9TEM0
LinkDB All DBs
Position
complement(3791334..3792236)
Genome map
AA seq 300 aa AA seqDB search
MDVEPSRGGPDLRDAHRFAVEAAQAAGRLLRRGTRGEVHARAKNDTGDLVTDLDLAAERL
IVDRIRARWPEHGVIAEEGGEYAPDTAWAWLVDPLDGTNNVAIGLPAYVVGIALCDNGSP
VLGVVHDPVAGRTWSAVRGRGAFVHASGPAARPLRAAQRPVPSAPVLAWTQGHEVRRDDS
TARALKVVLDTSARRVLQLWAPLLSWVMLARGDIDGIVGYRPEAVDLPAGMLLAVEAGMA
VRALDGGTFDDRYGCPADRRSFVAGPPETIDRLVKLVTAAQWIEPQVRRLTPVGLGSVGW
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggagccgagcagaggcgggcccgacctgcgcgacgcgcaccggttcgcggtg
gaggcagcgcaggcggcgggccgcctgctgcgccggggcacccggggggaggtgcacgcc
cgggccaagaacgacaccggtgacctggtgaccgacctcgacctggccgccgagcggctg
atcgtcgaccggatccgggcccgctggccggagcacggcgtgatcgccgaggagggcggc
gagtacgccccggacaccgcgtgggcgtggctcgtcgacccgctggacggcaccaacaac
gtggcgatcgggctgcccgcgtacgtggtcggcatcgccctgtgcgacaacggctcgccg
gtgctcggcgtggtgcacgacccggtcgcgggccggacctggtcggcggtgcgcggccgg
ggcgcgttcgtgcacgcgtccggcccggccgcgcggccgctgcgggccgcgcagcgcccg
gtgccgtccgcgccggtgctggcctggacccaggggcacgaggtacgccgcgacgacagc
accgcccgggcgttgaaggtggtgctggacaccagcgcgcgccgggtgctgcaactgtgg
gcgccgttgctgtcctgggtgatgctggcccgcggcgacatcgacggcatcgtcggctac
cgtcccgaggcggtcgacctgccggccgggatgctgctcgccgtcgaggccggcatggcg
gtccgcgcgctcgacggcggcactttcgacgaccggtacggctgccccgccgaccggcgc
agcttcgtggccgggccgccggagaccatcgaccggctggtcaaactggtcaccgcggca
cagtggatcgagccgcaggtccgccgcctcaccccggtcggtctcggctcggtcggctgg
tga

DBGET integrated database retrieval system