KEGG   Micromonospora aurantiaca: Micau_3984
Entry
Micau_3984        CDS       T01296                                 

Definition
(GenBank) Methyltransferase type 11
  KO
K13307  dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.235]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00523  Polyketide sugar unit biosynthesis
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mau00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Micau_3984
Enzymes [BR:mau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.235  dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     Micau_3984
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_31 Methyltransf_12 NodS Methyltransf_2 Methyltransf_15 tRNA_U5-meth_tr Ubie_methyltran MetW TPMT CMAS
Other DBs
NCBI-ProteinID: ADL47507
UniProt: D9T281
LinkDB
Position
complement(4525267..4526019)
AA seq 250 aa
MTTSVPAAGMYGEEQAEVYELVHRARGKDYDEEAAFVAEQARALLPGAATLLDVACGTGA
HLRAFARLFDRVEGLELSPAMVEAARTNIPGAVVHHGDMRSFHLGERYDVITCMFGSVGY
LTDVEELNAALRRFAAHLSPGGVVAIDPWWFPDTYLDGYVSASLVEADGTTVVRVSHSKR
DGDASRMEVHYIVARPTGGVHHFVEQHRITLFPRDTYEKAFRGAGLSVRYLEGSQSGRGL
FVGCAGHQED
NT seq 753 nt   +upstreamnt  +downstreamnt
atgacgacatcggtgccggcggccggcatgtacggcgaggaacaggccgaggtgtacgag
ctggtgcaccgtgcccgaggcaaggattacgacgaggaggccgcgttcgtcgccgagcag
gcgcgggcgttgctgcccggcgctgcgaccctgctcgacgtcgcctgcggcaccggtgcg
cacctgcgcgcgttcgctcggctcttcgaccgggtggagggcctggaactgtcccctgcg
atggtcgaggcggcccgcacgaacatcccgggggcggtcgtgcaccacggcgacatgcgc
tccttccatctcggcgagcggtacgacgtgatcacctgcatgttcggctccgtgggttac
ctcaccgacgtcgaggagctgaacgcggccctgcggcgcttcgcggcgcacctctcgccc
ggcggtgtggtcgcgatcgacccttggtggttcccggacacctacctcgacggatacgtg
tcggcctccctcgtcgaggccgacgggacgaccgtcgtacgcgtctcgcactccaagcgc
gacggcgacgcttcccgaatggaggtccactacatcgtcgctcgccccaccggcggcgtc
caccacttcgtcgagcagcatcgcatcacgctcttcccccgcgacacgtatgagaaggca
ttccggggcgcgggattgagcgtgcgctacctcgagggcagccagtcgggccgtggcctc
ttcgtcggctgtgccggacaccaggaggactga

DBGET integrated database retrieval system