KEGG   Micromonospora aurantiaca: Micau_4838
Entry
Micau_4838        CDS       T01296                                 

Definition
(GenBank) undecaprenyl diphosphate synthase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00900  Terpenoid backbone biosynthesis
mau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mau00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Micau_4838
Enzymes [BR:mau01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     Micau_4838
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: ADL48347
UniProt: D9T9H6
LinkDB
Position
complement(5454189..5455001)
AA seq 270 aa
MIRSTRATRREPVPPTPHPSGARPPALPPAAVPRHVAIVMDGNGRWAKERGLPRTKGHEQ
GEHSLFDAVEGAIEMGIPYLSAYAFSTENWRRSPDEVRFLMGFNRDVIRRRRDQLVDLGV
RVVWSGRAGRLWKSVISELQTAEEMSRGNSTLTLQFCVNYGGQAEIADAAAGIARDVAAG
RLDPAKVNEKTVARYLYHPEVPEVDLFLRPSGEQRISNFLLWQTAYAELVYLDTLWPDFD
RRHLWYACELYAQRDRRFGGALPNPVAPGA
NT seq 813 nt   +upstreamnt  +downstreamnt
gtgatccgatcgacgagggcgacccgccgcgagccggtgccgccgaccccgcacccctcc
ggagcccgtccgccggcgctgccgcccgccgcggtgccccggcacgtcgccatcgtgatg
gacggcaacggccgctgggccaaggagcgcgggctgccccgcaccaaggggcacgagcag
ggcgagcacagcctgttcgacgccgtcgagggcgcgatcgagatggggatcccctacctg
tcggcgtacgcgttctccaccgagaactggcggcgctcgccggacgaggtccgcttcctg
atgggcttcaacagggacgtcatccgccgccgccgcgaccagctcgtcgacctgggcgtc
cgggtggtctggtcgggccgtgccggccggctgtggaagagcgtcatctccgagttgcag
accgccgaggagatgtcgcgcggcaactcgacgctgacgctgcagttctgcgtcaactac
ggcggccaggcggagatcgccgacgccgccgccgggatcgcccgcgacgtcgcggccggc
cggctcgacccggccaaggtgaacgagaagacggtggcgcgctacctctaccaccccgag
gtgcccgaggtcgacctgttcctgcgcccctccggcgagcagcgcatctccaacttcctg
ctctggcagaccgcgtacgccgagctggtctacctggacacgctctggcccgacttcgac
cgccgccacctctggtacgcctgcgagctgtacgcccagcgcgaccgccgcttcggcggc
gccctgcccaacccggtcgccccgggcgcctga

DBGET integrated database retrieval system