KEGG   Micromonospora aurantiaca: Micau_5182Help
Entry
Micau_5182        CDS       T01296                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00500  Starch and sucrose metabolism
mau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Micau_5182
Enzymes [BR:mau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Micau_5182
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Micau_5182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase GHL5
Motif
Other DBs
NCBI-ProteinID: ADL48689
UniProt: D9TCQ2
LinkDB All DBs
Position
complement(5826856..5828508)
Genome map
AA seq 550 aa AA seqDB search
MGDRWYQEAVVYCLDVDTYADSDGDGVGDFQGLIGRLDYLARLGVTCLWLNPIHPSPNED
DGYDATDFYNVDPRLGTLGDFAELLHQASNRGIRVIIDLVVNHTSDQHPWFQSARSSPDS
PYRDWYVWADHEPDDRHQGMVFPGEQHETWTYDRTAKAWYYRRFYKFQPDLNIENPKVRA
EIKKITSFWLQLGVSGFRMDAVPFIIERTEPGNPNSPKDFDFLTDLRQHVQWRRGDAVLL
AEANVEPDELPVYFGDGSGSGNRIHMLFDFMLNGRLMLALAREDPEVIIEALRDTPKLPT
GGQWATFLRNHDEIDLSRLTADQRNDVLAKFGPDENMQLYGRGIRRRLAPMLGNDRRHME
LAYSLQFSLRGTPVLRYGEEIGMGENLSLDGRDAIRTPMQWSYADNAGFSAAEPEKLVRP
VIDKGEYGYQKVNVTAQRKDPRSLLGWFERMIRTLREAPETGSGSTTHIDVPMPPGVLAH
RADGRTGTMVFLHNLGTEDVEVDLSTLAPEADLPIDVLSDRNYEDVGKLDRLKLGGYGYR
WIRLCRGHER
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacaggtggtatcaggaggcggtcgtctactgcctcgacgtcgacacgtacgcg
gactccgacggcgacggggtgggtgacttccaggggctgatcggccggctggactacctg
gcccggctcggcgtgacctgcctgtggctgaacccgatccacccctcgccgaacgaggac
gacgggtacgacgccaccgacttctacaacgtcgacccgcgcctggggacgctcggcgac
ttcgccgagctgctgcaccaggcgagcaacaggggcatccgggtgatcatcgacctggtg
gtcaaccacacctcggaccagcacccgtggttccagtccgcccggtcctcgcccgactcg
ccgtaccgggactggtacgtctgggccgaccacgagccggacgaccgccaccagggcatg
gtcttccccggcgagcagcacgagacgtggacctacgaccggaccgccaaggcgtggtac
taccgccgcttctacaagttccagccggacctgaacatcgagaacccgaaggtccgcgcg
gagatcaagaagatcacctcgttctggctccaactcggcgtctccggcttccgtatggac
gcggtgccgttcatcatcgagcgcaccgagccgggcaacccgaactcgccgaaggacttc
gacttcctcaccgacctgcgccagcacgtgcagtggcggcgcggcgacgcggtcctgctg
gccgaggcgaacgtcgagccggacgagctgcccgtctacttcggcgacggcagcggctcg
ggcaaccggatccacatgctcttcgacttcatgctcaacggccggctgatgctcgccctg
gcccgggaggacccggaggtgatcatcgaggcgttgcgcgacaccccgaagctgcccacc
ggcggccagtgggcgacgttcctgcgcaaccacgacgagatcgacctgtcccggctcacc
gccgaccagcgcaacgacgtgctggcgaagttcgggccggacgagaacatgcagctctac
ggccggggcatccgccgtcgtctcgcgcccatgctcggcaacgaccgccggcacatggag
ctggcgtactcgctccagttctcgctgcgcggcacgccggtgctgcgctacggcgaggag
atcggcatgggggagaacctgtcgctggacgggcgcgacgcgatccgtaccccgatgcag
tggtcgtacgcggacaacgccggcttctccgccgccgagccggagaagctggtccgcccg
gtgatcgacaagggtgagtacggctaccagaaggtcaacgtcaccgcccagcgcaaggat
ccgcggtcgctgctcggctggttcgagcggatgatccggacgctgcgcgaggcgccggag
accggctcgggcagcaccacccacatcgacgtgccgatgccgccgggcgtgctcgcgcac
cgcgccgacggtcgtaccgggaccatggtcttcctgcacaacctcggcaccgaagacgtc
gaggtcgacctgagcacgctggcgccggaggcggatctgccgatcgacgtgctcagcgac
cgcaactacgaggacgtgggcaagctcgaccggctcaagctcggcgggtacggctaccgg
tggatccggctctgccggggccacgagcggtag

DBGET integrated database retrieval system