KEGG   Micromonospora aurantiaca: Micau_5235Help
Entry
Micau_5235        CDS       T01296                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
mau  Micromonospora aurantiaca
Brite
KEGG Orthology (KO) [BR:mau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Micau_5235
Enzymes [BR:mau01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Micau_5235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A BtrH_N
Motif
Other DBs
NCBI-ProteinID: ADL48741
UniProt: D9TCV4
LinkDB All DBs
Position
5888988..5889392
Genome map
AA seq 134 aa AA seqDB search
MRLPRILTPRVTASAHCDLPCGVYDPAQARIEAESVKMICEKYQANTDPEFRTRAILIKE
QRAELVKHHLWVLWTDYFKAPHFEKYPHLHQLFNEATKLAGAAGAKGGTDPAKADELLAK
IDEISKIFWETKQA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttccccgcatcctcacgccccgggtgacggccagcgctcactgcgacctgccc
tgcggcgtatacgacccggcccaggcccggatcgaggccgagtcggtcaaaatgatctgc
gagaagtaccaggccaacaccgacccggagttccgcacccgcgccatcctgatcaaggag
cagcgggcggagctggtcaagcaccacctgtgggtgctctggaccgactacttcaaggcg
ccgcacttcgagaagtacccgcacctgcaccagctgttcaacgaggccaccaagctggcc
ggcgcggccggcgccaagggcggcaccgacccggccaaggccgacgagctgctggcgaag
atcgacgagatctcgaagatcttctgggagaccaagcaggcgtga

DBGET integrated database retrieval system