KEGG   Micromonospora aurantiaca: Micau_5381Help
Entry
Micau_5381        CDS       T01296                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mau  Micromonospora aurantiaca
Pathway
mau00020  Citrate cycle (TCA cycle)
mau00480  Glutathione metabolism
mau01100  Metabolic pathways
mau01110  Biosynthesis of secondary metabolites
mau01120  Microbial metabolism in diverse environments
mau01130  Biosynthesis of antibiotics
mau01200  Carbon metabolism
mau01210  2-Oxocarboxylic acid metabolism
mau01230  Biosynthesis of amino acids
Module
mau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mau_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Micau_5381
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Micau_5381
Enzymes [BR:mau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Micau_5381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: ADL48887
UniProt: D9TE04
LinkDB All DBs
Position
complement(6038801..6040018)
Genome map
AA seq 405 aa AA seqDB search
MAKIKVNNPVVEIDGDEMTRIIWKQIREQLILPYLDVDLHYYDLSIQHRDATDDQVTVDA
ANAIKEHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIMSNVPRL
VPGWTKPIIIGRHAHGDQYKATDFVVPGPGTVTITYTPADGGTPMEMEVANFPGGGIAMG
MYNYDESIRDFARASFRYGLDRGYPVYMSTKNTILKAYDGRFKDIFAEVFENEFKAEFEA
AGLTYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLSPDGR
TVEAEAAHGTVTRHYRQYQKGEKTSTNPIASIYAWTRGLAHRGKLDGTPAVTEFADTLEK
VIVDTVEGGQMTKDLALLISRDAPWLTTDEFMNALDENLARKLAA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtaaacaacccggtcgtggagatcgacggcgacgagatgacccgg
atcatctggaagcagatccgggagcagctgatcctgccctacctcgacgtcgacctgcac
tactacgacctgtcgatccagcaccgtgacgccaccgacgaccaggtcacggtcgacgcc
gccaacgccatcaaggagcacggcgtcggcgtcaagtgcgccaccatcaccccggacgag
gcccgggtggaggagttcggcctgaagaagatgtggcggtcgccgaacggcaccatccgc
aacatcctcggcggcgtggtcttccgcgagccgatcatcatgtcgaacgtgccgcggctc
gtcccgggctggaccaagccgatcatcatcggccggcacgcgcacggcgaccagtacaag
gccaccgacttcgtcgtccccggcccgggcacggtgaccatcacctacaccccggccgac
ggcggcaccccgatggagatggaggtcgccaacttccccggcggcggcatcgccatgggc
atgtacaactacgacgagtcgatccgggacttcgcccgcgcctcgttccggtacggcctg
gaccgcggctacccggtctacatgtcgaccaagaacaccatcctcaaggcgtacgacggc
cggttcaaggacatcttcgccgaggtgttcgagaacgagttcaaggccgagttcgaggcc
gccggcctcacctacgagcaccggctgatcgacgacatggtcgccgccgcgctcaagtgg
gagggcggatacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacaccgtc
gcgcagggcttcggctcgctcggcctgatgacctcggtgctgctgtccccggacggccgc
accgtcgaggccgaggccgcccacggcaccgtcacccggcactaccggcagtaccagaag
ggcgagaagacctcgaccaacccgatcgcctcgatctacgcctggacccggggcctggcc
caccggggcaagctggacggcaccccggcggtcaccgagttcgccgacacgctggagaag
gtcatcgtggacaccgtcgagggtggccagatgaccaaggacctcgcgctgctcatctcg
cgggatgccccgtggctgaccaccgacgagttcatgaacgcgctcgacgagaacctggcg
cgcaagctcgccgcctga

DBGET integrated database retrieval system