KEGG   Microbacterium aurum: BOH66_03975Help
Entry
BOH66_03975       CDS       T04977                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
maur  Microbacterium aurum
Pathway
maur00330  Arginine and proline metabolism
maur01100  Metabolic pathways
maur01110  Biosynthesis of secondary metabolites
maur01130  Biosynthesis of antibiotics
maur01230  Biosynthesis of amino acids
Module
maur_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:maur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BOH66_03975
Enzymes [BR:maur01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     BOH66_03975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored ApbA Shikimate_DH NAD_Gly3P_dh_N Sacchrp_dh_NADP NAD_binding_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: APZ33522
UniProt: A0A1P8U5X8
LinkDB All DBs
Position
796744..797577
Genome map
AA seq 277 aa AA seqDB search
MAEDLPSIAILGAGSMGGAILQGLVRSGRAPRIVVTNRTAAKAADLEGLAGVTSLALEQD
PAANTTAAAGADIVLIGVKPVMVPDLLREIAPVLRPGVIVVSLAAGVTLATFASIVGDDV
AVVRSMPNTPAVVGKAVTGIAAGPAASAADVALVRELFETCGVVIELAEDQIDALGTISG
SGPAYVFLLIEDLTEAARGKGFSDADARLMAEQTFIGAAALLDATREDPAELRRRVTSPK
GTTERAIAVLQGANLAGIFAEATDAALARSRELAAGA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagacctcccctcgatcgcgattctcggtgccggttcgatgggtggcgccatt
ctccaggggctcgtccgctccggccgtgcgccgcggatcgtcgtcaccaaccggacggcg
gccaaggccgcagacctcgaaggactggccggcgtgacgagcctggcgctcgagcaggat
ccggccgccaacacgaccgccgcggcgggcgccgacatcgtcctcatcggcgtgaagccc
gtgatggttcccgacctgctgcgcgagatcgccccggtcctccgccccggtgtgatcgtc
gtgagcctcgccgccggcgtcaccctcgcgaccttcgcgtcgatcgtcggggacgacgtc
gccgtcgtccggtcgatgccgaacacgccggccgtggtcggcaaggccgtcacggggatc
gctgccggtcccgcggcatccgctgccgacgtcgccctcgtgcgggaactcttcgagacg
tgcggcgtcgtgatcgaactggccgaagatcagatcgacgcgctcggcaccatctcgggg
tcgggcccggcgtacgtcttcctgctgatcgaggacctcaccgaggccgcgcgcggcaag
ggcttctccgacgcggatgcgcgcctcatggccgagcagaccttcatcggcgccgccgcg
ctgctggacgcgacccgggaagacccggccgaactccgccgccgggtgacgagcccgaag
ggcacgaccgaaagggcgatcgccgtgctccagggggcgaacctcgccggcatcttcgcc
gaggcgacggatgccgcgctcgcgcgctcccgcgagctcgccgccggcgcctga

DBGET integrated database retrieval system