KEGG   Microbacterium aurum: BOH66_04500Help
Entry
BOH66_04500       CDS       T04977                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
maur  Microbacterium aurum
Pathway
maur00250  Alanine, aspartate and glutamate metabolism
maur00280  Valine, leucine and isoleucine degradation
maur00310  Lysine degradation
maur00410  beta-Alanine metabolism
maur00640  Propanoate metabolism
maur00650  Butanoate metabolism
maur01100  Metabolic pathways
maur01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:maur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BOH66_04500
   00650 Butanoate metabolism
    BOH66_04500
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BOH66_04500
   00280 Valine, leucine and isoleucine degradation
    BOH66_04500
   00310 Lysine degradation
    BOH66_04500
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BOH66_04500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:maur01007]
    BOH66_04500
Enzymes [BR:maur01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BOH66_04500
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BOH66_04500
    2.6.1.48  5-aminovalerate transaminase
     BOH66_04500
Amino acid related enzymes [BR:maur01007]
 Aminotransferase (transaminase)
  Class III
   BOH66_04500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: APZ33610
UniProt: A0A1P8U668
LinkDB All DBs
Position
894958..896307
Genome map
AA seq 449 aa AA seqDB search
MSMTDSTVLGGPTLAQERRIVTTIPGPRSQELLDRKSAAVASGVAHTVPIEAVAAGGGVV
VDADGNSLIDLGSGIAVTSVGNAHPAVVAAVQAAVAQMTHTCFMISPYASYVAVAERLNR
LTPGDHAKKSALFNSGAEAVENAVKIARKYTGRQAVVAFDHAYHGRTNLTMALTAKSMPY
KSGFGPFASEVYRAPASYPFRDGRSGADAAAQAISLIEKQIGADNLAAVIIEPIQGEGGF
IVPADGFLSAIVDWCRANGVVFIADEVQTGFARTGAMFASELFGIVPDLITTAKGIAGGM
PLAAVTGRAEIMDATHGGGLGGTYGGNPVACAAAIAAIDAFENDGLIDRAREIGGILRAR
LESLQAADPRIGEVRGRGAMIAVEFVDPATKAPDAALTAAVAKAAIADGVIVLTCGTYGN
VIRFLPPLTIGAELLHEGLDVVAAALAAH
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgactgacagcaccgtcctgggcggcccgaccctggcgcaggagcgccgcatc
gtcacgaccatcccgggcccgcgctcgcaggaactgctcgaccgcaagtcggccgccgtg
gcgtcgggcgtcgcgcacaccgtgccgatcgaggccgtggccgctggcggtggcgtcgtc
gtggatgccgacggcaactccctcatcgacctcggcagcggcatcgccgtcacgagcgtc
ggcaacgcccacccggccgtcgtcgcggccgtgcaggcggccgtcgcgcagatgacccac
acctgcttcatgatctcgccgtacgcgtcatatgtcgccgtcgccgagaggctcaaccgc
ctgacgccgggcgaccacgccaagaagtcggcgctgttcaactccggcgccgaggccgtc
gagaacgccgtcaagatcgcgcgcaagtacaccgggcgtcaggccgtcgtcgcgttcgat
cacgcctatcacggccgcacgaacctcacgatggccctcacggccaagtcgatgccgtac
aagagcggcttcggccccttcgcctccgaggtgtaccgcgcaccggcgtcgtacccgttc
cgcgacggccggagcggggcggatgccgcggcccaggcgatctcgctcatcgagaagcag
atcggggccgacaatctcgccgccgtcatcatcgagccgatccagggcgagggcgggttc
atcgtcccggccgacgggttcctttccgcgatcgtcgactggtgccgcgcgaacggcgtc
gtcttcatcgccgacgaggtgcagaccggtttcgcccggaccggcgcgatgttcgcgagc
gagctgttcggcatcgtgccggatctgatcaccacggccaagggcatcgcgggggggatg
cccttggcggcggtcaccggtcgcgccgagatcatggacgcgacccacggcggcgggctc
ggcggcacgtacgggggcaatcccgtggcgtgcgcggcggcgatcgcggcgatcgacgcc
ttcgagaacgacggcctcatcgaccgggcgcgggagatcggggggatcctccgcgcccgg
ctcgagtcgctgcaggccgccgatccccgcatcggcgaggtccgggggcgcggcgcgatg
atcgcggtcgagttcgtcgaccccgccacgaaggcccccgacgcggccctcacggccgcc
gtcgccaaggcggcgatcgccgacggcgtcatcgtgctgacctgcggcacgtacggcaac
gtcatccgcttcctgccgccgctgacgatcggcgccgagctcctgcacgagggactcgac
gtcgtcgccgccgccctcgccgcccactga

DBGET integrated database retrieval system