KEGG   Microbacterium aurum: BOH66_04525Help
Entry
BOH66_04525       CDS       T04977                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
maur  Microbacterium aurum
Pathway
maur00250  Alanine, aspartate and glutamate metabolism
maur00310  Lysine degradation
maur00350  Tyrosine metabolism
maur00650  Butanoate metabolism
maur00760  Nicotinate and nicotinamide metabolism
maur01100  Metabolic pathways
maur01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:maur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BOH66_04525
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BOH66_04525
   00310 Lysine degradation
    BOH66_04525
   00350 Tyrosine metabolism
    BOH66_04525
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BOH66_04525
Enzymes [BR:maur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     BOH66_04525
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     BOH66_04525
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     BOH66_04525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APZ33615
UniProt: A0A1P8U665
LinkDB All DBs
Position
901664..903028
Genome map
AA seq 454 aa AA seqDB search
MTYAVVNPATGETLATYPTATDAEVEAAVAAADSAARSWGRTSTPAERADLLRRVAELHR
ERRDELAAIIVREMGKPLAAAEGEVDFAADITEYYADNIDKITGDTPLEILGEGSAVIRR
APLGALLGIMPWNFPYYQVARFAAPNLALGNTILLKHASQCPQSAAAIAQMYADAGFPAG
AYADVRLTNDQAAAVIADRRVHGVSVTGSERAGSAVAEVAGRNLKKVVLELGGSDPFIVL
STADLDATVQMAVDARLDNNGQSCNGAKRFIVVDELYDAFVAAFAAALAEAKVGDPFAED
TVLGPLSSLAAAERLQEQVDRAVQQGATLVTGGTRDGAFFPGTVLTGVTPEMDAYREEFF
GPVGVVYRVADEDEAIEIANGTEFGLGSYVFTTDPEQAQRVADRIDAGMVYVNVVLADSP
ELPFGGIKRSGTGRELGLLAADEFVNKKLVRVAG
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgacctacgcggttgtgaaccccgccaccggcgagaccctggccacctacccgacggcg
acggatgccgaggtcgaggcggctgtcgcggccgccgactccgcggcccgcagctggggg
cgcacctcgacccccgccgagcgcgccgacctgctgcggcgggtcgccgagctgcaccgg
gagcgccgcgacgagctcgcggcgatcatcgtgcgggagatgggcaaaccgctcgccgct
gccgagggcgaagtcgacttcgcggcggacatcacggagtactacgccgacaacatcgac
aagatcaccggcgacacgcccctggagatcctcggcgaggggagcgccgtgatccgccgc
gcgccgctcggtgccctcctgggcatcatgccgtggaacttcccctactaccaggtggcg
cgtttcgccgcccccaacctggcgctcggcaacacgatcctcctcaagcacgcgtcgcag
tgcccgcagtccgccgccgcgatcgcgcagatgtacgccgacgccgggttccccgcgggc
gcctacgccgacgtgcgtctgaccaacgatcaggccgcggccgtcatcgccgaccgccgt
gtgcacggcgtctcggtcaccgggtcggagcgcgccggatccgccgtcgcggaggtcgcg
gggcggaacctcaagaaggtcgtcctcgagctcggcgggtcggacccgttcatcgtgctc
tcgaccgccgacctggacgccaccgtgcagatggccgtcgacgcacgcctggacaacaac
gggcagtcgtgcaacggcgcgaagcgcttcatcgtcgtcgacgagctgtacgacgccttc
gtggcggcgttcgccgcagccctggccgaggcgaaggtgggcgacccgttcgcggaggac
accgtactcggtccgctgtcctcgctcgccgccgcggagcggctgcaggagcaggtcgac
cgtgccgtccagcagggtgccaccctcgtcaccggcggcacgcgcgacggcgcgttcttc
cccggcaccgtcctcaccggcgtgacgccggagatggacgcctaccgggaggagttcttc
ggcccggtgggtgtcgtgtaccgggtggcggacgaggacgaggcgatcgagatcgccaac
ggcaccgagttcggtctcggctcgtacgtgttcacgaccgaccccgagcaggcgcagcgc
gtcgccgatcgcatcgacgccggcatggtctacgtcaacgtcgtgctggcggactcgccc
gagctgcccttcgggggcatcaagcgcagcggtacggggcgcgagttggggctgctggcc
gccgacgagttcgtcaacaagaagctcgtccgcgtcgccgggtga

DBGET integrated database retrieval system