KEGG   Mycobacterium avium 104: MAV_3830Help
Entry
MAV_3830          CDS       T00433                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mav  Mycobacterium avium 104
Pathway
mav00473  D-Alanine metabolism
mav00550  Peptidoglycan biosynthesis
mav01100  Metabolic pathways
mav01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MAV_3830
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MAV_3830
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    MAV_3830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mav01011]
    MAV_3830
Enzymes [BR:mav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MAV_3830
Peptidoglycan biosynthesis and degradation proteins [BR:mav01011]
 Precursor biosynthesis
  Amino acid ligase
   MAV_3830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST RimK CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABK66362
UniProt: A0QJB2
LinkDB All DBs
Position
complement(3957791..3958900)
Genome map
AA seq 369 aa AA seqDB search
MNASQRVRVAVVFGGRSNEHAISCVSAGSILRNLDPRRFEVVAIGITPQGSWVLTDGDPA
ALAISDRQLPEVTSASGTELALPADPGRSGQLVSLPPGASEVLASVDVVFPVLHGPYGED
GTIQGLLELAGVPYVGAGVFASAAGMDKEFTKKLFAAEGLPIGDYAVLRPSQSTLSLQDR
ERLGLPVFVKPARGGSSIGVSRVSSWDELDAAVAAARDHDPKVIVEAAIAGRELECGVLE
MPDGTVQASTVGEIRVAGVRGREDSFYDFATKYLDDTAELDVPAKVDDEIADAVRELAIR
AFKAVDCQGLARVDFFLTETGPVLNEINTMPGFTTISMYPRMWAASGVDYPSLLATMVET
ALTRGVGLR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgccagccagcgggtccgcgtcgccgtcgtcttcggcgggcgcagcaacgagcac
gccatctcgtgcgtctcggccggcagcatcctgcgcaacctcgacccgcggcggttcgag
gtcgtcgcgatcggcatcaccccgcaaggctcgtgggtgctcaccgacggcgacccggcc
gcgctggcgatcagcgaccggcaactgcccgaggtgacgtccgcgtcggggaccgagctg
gcgctgccggcggatccggggcgcagcggccaactggtttcccttccccccggcgccagt
gaggtgttggcctccgtcgacgtggtgttcccggtgctgcacggcccgtacggggaggac
ggcacgatccaggggctgctcgaactcgccggggtgccctacgtgggggccggcgtgttc
gccagcgccgcgggcatggacaaggaattcaccaagaagctgttcgccgccgagggattg
ccgatcggcgactacgcggtgctgcgtccgtcgcagtccacgctgtcgctgcaggaccgc
gagcggctgggcttgccggtgttcgtcaaacccgcccggggcggctcctcgatcggcgtc
agccgggtctcgagctgggacgagctggacgccgccgtggccgccgcccgcgaccacgat
cccaaggtcatcgtcgaggcggccatcgccggccgggagctggagtgcggggtgctcgaa
atgcccgacggcacagtgcaagccagcacggtcggtgagatccgggtggccggggtgcgc
gggcgtgaggactcgttctacgacttcgcaaccaaatacctcgacgacacagccgaattg
gacgtgcccgccaaggtcgacgacgaaatcgccgacgcggtgcgcgaattggcgatccgc
gcattcaaggccgttgactgccaagggctggcccgggtggacttcttcctcaccgagacc
gggccggtgctcaacgagatcaacacgatgccgggcttcaccaccatctcgatgtacccg
cggatgtgggcggccagcggcgtggactacccgagtctgctggccaccatggtggagacg
gccctgacccgcggcgtcgggctgcgctag

DBGET integrated database retrieval system