KEGG   Mycobacterium avium 104: MAV_3969Help
Entry
MAV_3969          CDS       T00433                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
mav  Mycobacterium avium 104
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ABK69462
UniProt: A0A0H3A4K7
LinkDB All DBs
Position
4095308..4096750
Genome map
AA seq 480 aa AA seqDB search
MDHDAAVRTDGHGRRADVIRVISPHTERPVAEVDAATPSDVDAAVAAARAAFDAGTWSRG
GPSHRIAAIRRLADIYDRRRAEMAETITAEIGAPISFARRAQVGLPAFMIRAFCDLAERH
PWQETRPGFFGSDVYVRREPVGVVAAIVPWNMPQFLIVTKLIPALLAGCTVVLKPAPESP
LDALLLAEMISEADLPPGAVSVLPGDAALGAYLAGHRGVDKVSFTGSTAAGRAVAAACAA
NLTKVSLELGGKSAALVLDDAPPDKVAAGVRAASLSNSGQICNALTRVLVPQARHDDYVD
ALAAHMGGLRVGDPADPDTDLGPLVSRRQQQRVRDYIRIGQQEGARLVVGGADMPDGLDR
GWYVRPTLFAAAGNAMRIAREEIFGPVITVIPYRDDDEAVAIANDSDYGLAGSVWSDDTD
RALALATRIHTGTVGVNQGYTMDPFAPFGGVKASGYGRELGPEGLDGYLDTKSIAVAPSG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggaccacgacgccgcagtgcgaaccgacggacacggccggcgcgccgacgtcatccgc
gtcatctcgccgcacaccgagcggcccgtcgccgaggtcgatgcggcgacaccgtccgac
gtcgacgcggcggtggccgcggcgcgagcggcgttcgacgctggaacgtggagccgcggc
gggccgtcacaccgcatcgccgcgatccgccggctggccgacatctacgaccggcgacgc
gccgagatggccgagaccatcaccgccgagatcggcgccccgataagcttcgcccggcgt
gcccaggtgggcctgcccgccttcatgatccgcgcgttctgcgacctggccgagcgccat
ccctggcaggagaccaggccgggcttcttcgggagcgacgtgtacgtgcgcagggaaccc
gtcggcgttgtcgcggcgatcgtgccgtggaacatgccgcagttcctcatcgtcaccaaa
ctcatcccggccctgctggccggctgcaccgtcgtgctcaagccggcacccgaaagtcct
ttggacgcactgcttttagccgagatgatctccgaggccgacctgccgcccggcgcggtc
agcgtgctgcccggcgacgccgcgctgggcgcctacctcgccgggcaccgcggggtggac
aaggtgtccttcaccggctcgacggccgccgggcgcgccgtcgccgcggcctgcgcggcc
aacctcaccaaggtcagtctggaactgggcggcaagtccgccgccctggtgctcgacgat
gcgccgccggacaaggtggccgccggggtgcgcgcggccagcctgtccaacagcggccag
atctgcaatgcgctgacccgagtgctggttccccaagcgcgccatgacgattacgtcgac
gcgctcgccgcccacatgggcggcctgcgagtcggcgaccccgccgacccggacaccgac
ctcggcccgctggtgtcgcgccgccagcagcagcgggtccgcgactacatccggatcggc
cagcaggagggggcgcggttggtggtcggcggtgcggatatgcccgacgggctcgaccgc
ggctggtatgtccggcccaccctgttcgccgccgccggcaacgccatgcgcatcgcacgc
gaagagatcttcggtccggtcatcaccgtcatcccataccgcgacgacgacgaggcggtg
gcgatcgccaacgactccgattacggcctggccgggtcggtgtggagcgacgacaccgac
cgcgcgctggcgctggccacccggattcacaccggcaccgtcggcgtcaaccagggctac
accatggacccgttcgcgccgttcggcggtgtcaaggccagcggctacggccgcgagctg
gggcccgaggggctcgacggctacctcgacacgaaatcgatcgcggtcgcgccgagcggc
tag

DBGET integrated database retrieval system