KEGG   Mycobacterium avium 104: MAV_4945Help
Entry
MAV_4945          CDS       T00433                                 

Definition
(GenBank) SAM-dependent methyltransferase
Organism
mav  Mycobacterium avium 104
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 Ubie_methyltran Peptidase_M66
Motif
Other DBs
NCBI-ProteinID: ABK68574
UniProt: A0QMC8
LinkDB All DBs
Position
5086812..5087573
Genome map
AA seq 253 aa AA seqDB search
MTDIFARRATLARSVRLLSQFRYERSEPARFYGALAADTAAMVDDLWRAGHGESAAGRTL
LDVGGGPGYFAAAFADAGVRYLGVEPDPGEMHAAGPVVAADTGTFVRASGMALPFADDSV
DICLSSNVAEHVPRPWQLGAEMLRVTRPGGLAVLSYTVWLGPFGGHEMGLTHYLGGSRAA
ARYARKHGHPAKNNYGSSLFEVSVADGLAWAACTGAELAAFPRYHPRWAWWLTSVPVLRE
FLVSNLVLVLQPQ
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacatcttcgcgcgccgggcgacgctggcccgctcggtgcggctgctgtcgcag
ttccgctacgaacggtcggagccggcccgcttctacggcgcgctggcggccgacaccgcg
gcgatggtggacgacctgtggcgggccgggcacggcgaatccgcggccggccgcaccctg
ctagacgtcggcggcgggccggggtatttcgcggcggccttcgccgacgccggcgtccgc
tatctgggcgtcgagcccgatcccggcgagatgcacgcggccggccccgtcgtcgccgcc
gacacgggcacgttcgtgcgcgcctcgggcatggcgctgccgttcgccgacgactcggtg
gacatctgcctgtcctccaacgtcgccgaacacgtgccgcggccctggcaactcggcgcc
gagatgctgcgggtgaccaggcccggcgggctggcggtgctctcctacaccgtgtggctg
ggcccgttcggcggccacgagatgggcctgacccactacctcggcgggtcccgcgccgcc
gcgcgctacgcccgcaagcacggccatccggccaaaaacaactacgggtcgtcgttgttc
gaggtgtcggtggccgacggcctggcgtgggcggcgtgcaccggcgccgagctggccgca
tttccccgctaccacccgcgatgggcgtggtggctgacctcggtcccggtgctgcgcgag
ttcctggtcagcaatctggtgctggtcctgcaaccccaatag

DBGET integrated database retrieval system