KEGG   Mycobacterium avium subsp. avium 2285 (S): LA64_20290Help
Entry
LA64_20290        CDS       T03691                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mava  Mycobacterium avium subsp. avium 2285 (S)
Pathway
mava00250  Alanine, aspartate and glutamate metabolism
mava00410  beta-Alanine metabolism
mava00430  Taurine and hypotaurine metabolism
mava00650  Butanoate metabolism
mava01100  Metabolic pathways
mava01110  Biosynthesis of secondary metabolites
mava01120  Microbial metabolism in diverse environments
mava02024  Quorum sensing
Module
mava_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mava00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LA64_20290
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LA64_20290
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LA64_20290
   00430 Taurine and hypotaurine metabolism
    LA64_20290
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LA64_20290
Enzymes [BR:mava01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LA64_20290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIR25465
LinkDB All DBs
Position
complement(4306693..4308072)
Genome map
AA seq 459 aa AA seqDB search
MPQHPSLPAHAIAPAYTGRLFTAPVPALRMPDESMDPDAAYRFIHDELMLDGSSRLNLAT
FVTTWMDPEAGRLMAETFDKNMIDKDEYPATAAIEQRCVCMVADLFHAEGLNDADPYSAC
GVSTIGSSEAVMLGGLAMKWRWRAKTKDWKKRTPNLVMGSNVQVVWEKFCRYFDVEPRYL
PMEEGRYVITPEQVVDAVDEDTIGVVAILGTTYTGELEPVADICGALDKLAARGGVDVPV
HVDAASGGFVVPFLHPELKWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRSKEYLPDELV
FRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYTKVMQTLSGTARWLGEQLRVS
EHCELISDGSAIPVVAFRLAKDRGYTEFDVSHELRTYGWQVPAYTMPDNATDVSVLRIVV
REGLSADLARALHDDAVSALTSLDKVKPGGHYDAQHFAH
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgccccaacatccttcgctgcccgcgcatgccattgccccggcctacaccggccggctg
ttcaccgcgccggtgcccgcgctgcggatgcccgacgagtcgatggatcccgacgccgcc
taccggttcatccacgacgagctgatgctcgacggcagctcccggctgaacctggccacc
ttcgtcaccacctggatggaccccgaggccgggcggttgatggccgagacgttcgacaag
aacatgatcgacaaggacgaatacccggccaccgcggccatcgagcagcgctgcgtgtgc
atggtcgccgacctgttccacgccgaaggtctgaacgacgccgacccgtacagcgcctgc
ggggtgtccaccatcgggtccagcgaggcggtgatgttgggcgggctggcgatgaagtgg
cggtggcgcgccaagaccaaggactggaagaagcgcaccccgaacctggtgatgggctcc
aacgtccaggtggtctgggagaagttctgccgctacttcgacgtcgagccccgctacctg
ccgatggaggagggccgctacgtcatcacccccgaacaggtcgtcgacgccgtcgacgag
gacaccatcggcgtggtggccatcctgggcaccacctacaccggcgagctggaaccggtc
gccgacatctgcggcgcgctggacaagctggccgcgcgcggcggcgtggacgtcccggtg
cacgtcgacgccgccagcggcgggttcgtggtgccgttcctgcaccccgagctcaagtgg
gacttccggctgccccgggtggtgtcgatcaacgtcagcgggcacaagtacgggctgacc
tatcccggcgtcggcttcgtggtgtggcgcagcaaggagtacctgcccgacgagctggtg
ttccgggtcaactacctgggcggcgacatgccgaccttcacgctgaacttctcgcgcccc
ggcaaccaggtggtcggccagtactacaacttcctgcggctgggccgcgagggctatacc
aaggtgatgcagacgctgtccggcacggcgcgctggctgggcgagcagctgcgggtcagc
gagcactgcgagctgatctcggacggctcggcgatcccggtggtcgccttccggctggcc
aaggaccgcggctacaccgagttcgacgtctcccacgagctgcgcacctacggctggcag
gtgcccgcctacaccatgcccgacaacgccaccgacgtctcggtgctgcgcatcgtggtg
cgtgaggggctgtcggccgacctggcccgggcgctgcacgacgacgccgtctcggcgcta
acctcgctggacaaggtcaagccgggcggccactacgacgcccagcacttcgcgcactga

DBGET integrated database retrieval system