KEGG   Mycobacterium avium subsp. avium 2285 (S): LA64_22455Help
Entry
LA64_22455        CDS       T03691                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mava  Mycobacterium avium subsp. avium 2285 (S)
Pathway
mava00220  Arginine biosynthesis
mava00250  Alanine, aspartate and glutamate metabolism
mava00290  Valine, leucine and isoleucine biosynthesis
mava01100  Metabolic pathways
mava01110  Biosynthesis of secondary metabolites
mava01130  Biosynthesis of antibiotics
mava01210  2-Oxocarboxylic acid metabolism
mava01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mava00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LA64_22455
   00290 Valine, leucine and isoleucine biosynthesis
    LA64_22455
   00220 Arginine biosynthesis
    LA64_22455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mava01007]
    LA64_22455
Enzymes [BR:mava01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LA64_22455
    2.6.1.66  valine---pyruvate transaminase
     LA64_22455
Amino acid related enzymes [BR:mava01007]
 Aminotransferase (transaminase)
  Class I
   LA64_22455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AIR25882
LinkDB All DBs
Position
4736589..4737881
Genome map
AA seq 430 aa AA seqDB search
MDSDGTIGGVTTHQLPVHSSAHHRQQRTFAQSSKLQDVLYEIRGPVHQHAARLEAEGHRI
LKLNIGNPAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILPARRAVVTRYELVDGFPRFD
VDDVYLGNGVSELITMTLQALLDNGDEVLIPSPDYPLWTASTSLAGGTPVHYLCDETQGW
QPDIADLESKITERTKALVVINPNNPTGAVYSGEILSQMVDLARKHELLLLADEIYDKIL
YDAAKHINVASLAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKDHAGSFIEGINLLANM
RLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDVAWSKLNEIPGVSCVKPAGALYA
FPRLDPEVYDITDDEQLVLDLLLQEKILVTQGTGFNWPAPDHLRIVTLPWARDLAAAIER
LGNFLVGYRQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggacagtgatggcaccattggtggtgtgacaacccaccagctgcctgtgcactcgtcc
gcgcaccatcgccagcagcgtactttcgcccagtcgtccaagctccaggacgtcctgtac
gagatccgcggcccggtacatcagcacgcggcgcggctggaggccgagggacaccgcatc
ctcaagctcaacatcggcaacccggcgccgttcggcttcgaggcgcccgacgtcatcatg
cgcgacatgatccaggccctgccgtacgcccagggctactccgactcgcagggcatcctg
cccgcacgccgggcggtggtcacccgctacgagttggtcgacgggttcccccgcttcgac
gtcgacgatgtctacctgggcaacggcgtgtccgaactgatcacgatgacgctgcaggca
ctgctcgacaacggcgacgaggtgctgatcccgtcgccggactacccgctgtggacggcg
tcgacctcgctggccggcggcacccccgtgcactacctgtgcgacgagacgcagggctgg
cagcccgacatcgccgatctggaatccaagatcaccgagcgcaccaaggcgctggtggtg
atcaacccgaacaacccgaccggcgcggtgtacagcggcgaaatcctgagccagatggtc
gatctggcgcgcaagcacgagctgctgctgctggccgacgagatctacgacaagatcctc
tacgacgccgccaagcacatcaacgtggcgtcgctggcgccggacatgctgtgcctgacc
ttcaacggcctgtcgaaggcgtaccgggtggccggctaccgcgccggctggctggcgatc
accggacccaaggaccacgccggcagcttcatcgagggcatcaacctgctggccaacatg
cggctgtgcccgaacgtcccggcgcagcatgcgatccaggtggccctgggcggccaccag
agcatcgaggacctggtgctgccgggcgggcggctgctcgagcagcgcgacgtggcgtgg
agcaagctcaacgagatccccggggtgtcctgcgtcaaacccgccggcgccctgtacgcg
tttccccggctggaccccgaggtctacgacatcaccgacgacgagcagctggtgctcgac
ctgctgctgcaggagaagatcctggtcacccagggcaccggcttcaactggccggcgccg
gatcacctgcgcatcgtgacgctgccgtgggcgcgggacctggccgccgcgatcgagcgg
ctgggcaacttcctggtcggctatcgacagtaa

DBGET integrated database retrieval system