KEGG   Mycobacterium avium subsp. avium 2285 (S): LA64_22455Help
Entry
LA64_22455        CDS       T03691                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mava  Mycobacterium avium subsp. avium 2285 (S)
Pathway
mava01100  Metabolic pathways
mava01110  Biosynthesis of secondary metabolites
mava01130  Biosynthesis of antibiotics
mava01210  2-Oxocarboxylic acid metabolism
mava01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mava00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LA64_22455
   00290 Valine, leucine and isoleucine biosynthesis
    LA64_22455
   00220 Arginine biosynthesis
    LA64_22455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mava01007]
    LA64_22455
Enzymes [BR:mava01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LA64_22455
    2.6.1.66  valine---pyruvate transaminase
     LA64_22455
Amino acid related enzymes [BR:mava01007]
 Aminotransferase (transaminase)
  Class I
   LA64_22455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AIR25882
LinkDB All DBs
Position
4736589..4737881
Genome map
AA seq 430 aa AA seqDB search
MDSDGTIGGVTTHQLPVHSSAHHRQQRTFAQSSKLQDVLYEIRGPVHQHAARLEAEGHRI
LKLNIGNPAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILPARRAVVTRYELVDGFPRFD
VDDVYLGNGVSELITMTLQALLDNGDEVLIPSPDYPLWTASTSLAGGTPVHYLCDETQGW
QPDIADLESKITERTKALVVINPNNPTGAVYSGEILSQMVDLARKHELLLLADEIYDKIL
YDAAKHINVASLAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKDHAGSFIEGINLLANM
RLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDVAWSKLNEIPGVSCVKPAGALYA
FPRLDPEVYDITDDEQLVLDLLLQEKILVTQGTGFNWPAPDHLRIVTLPWARDLAAAIER
LGNFLVGYRQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggacagtgatggcaccattggtggtgtgacaacccaccagctgcctgtgcactcgtcc
gcgcaccatcgccagcagcgtactttcgcccagtcgtccaagctccaggacgtcctgtac
gagatccgcggcccggtacatcagcacgcggcgcggctggaggccgagggacaccgcatc
ctcaagctcaacatcggcaacccggcgccgttcggcttcgaggcgcccgacgtcatcatg
cgcgacatgatccaggccctgccgtacgcccagggctactccgactcgcagggcatcctg
cccgcacgccgggcggtggtcacccgctacgagttggtcgacgggttcccccgcttcgac
gtcgacgatgtctacctgggcaacggcgtgtccgaactgatcacgatgacgctgcaggca
ctgctcgacaacggcgacgaggtgctgatcccgtcgccggactacccgctgtggacggcg
tcgacctcgctggccggcggcacccccgtgcactacctgtgcgacgagacgcagggctgg
cagcccgacatcgccgatctggaatccaagatcaccgagcgcaccaaggcgctggtggtg
atcaacccgaacaacccgaccggcgcggtgtacagcggcgaaatcctgagccagatggtc
gatctggcgcgcaagcacgagctgctgctgctggccgacgagatctacgacaagatcctc
tacgacgccgccaagcacatcaacgtggcgtcgctggcgccggacatgctgtgcctgacc
ttcaacggcctgtcgaaggcgtaccgggtggccggctaccgcgccggctggctggcgatc
accggacccaaggaccacgccggcagcttcatcgagggcatcaacctgctggccaacatg
cggctgtgcccgaacgtcccggcgcagcatgcgatccaggtggccctgggcggccaccag
agcatcgaggacctggtgctgccgggcgggcggctgctcgagcagcgcgacgtggcgtgg
agcaagctcaacgagatccccggggtgtcctgcgtcaaacccgccggcgccctgtacgcg
tttccccggctggaccccgaggtctacgacatcaccgacgacgagcagctggtgctcgac
ctgctgctgcaggagaagatcctggtcacccagggcaccggcttcaactggccggcgccg
gatcacctgcgcatcgtgacgctgccgtgggcgcgggacctggccgccgcgatcgagcgg
ctgggcaacttcctggtcggctatcgacagtaa

DBGET integrated database retrieval system