KEGG   Mycobacterium avium subsp. avium DJO-44271: NF84_04590Help
Entry
NF84_04590        CDS       T03430                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mavd  Mycobacterium avium subsp. avium DJO-44271
Pathway
mavd03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mavd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    NF84_04590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mavd03400]
    NF84_04590
Enzymes [BR:mavd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NF84_04590
DNA repair and recombination proteins [BR:mavd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     NF84_04590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AIV24010
LinkDB All DBs
Position
907092..909392
Genome map
AA seq 766 aa AA seqDB search
MNAPRAWPAEPTATPRVKLTNADKVLYPATGTTKADVFDYYTRIADVMIPHIAGRPVTRK
RWPNGVDQESFFEKQLASSAPDWLPRASVTHRSGTTTYPIIDSATGLAWIAQQAALEVHV
PQWRFVAEWTRSRAEELKPGPATRLVFDLDPGEGVTMAQLAEVARAVRDLIDGIGLQTFP
LTSGSKGLHLYTPLTEPVSSKGATVLAKRVAQQLEKTMPKLVTSTMTKSLRAGKIFVDWS
QNNGSKTTIAPYSLRGRDHPTVAAPRTWDELDDPALRHLRYDEVLTRVARDGDLLAELDA
SDNQTPVPDRLTKYRSMRDASKTPEPVPAAKPAAGRGNTFVIQEHHARRLHYDFRLERDG
VLVSWAVPKNLPDTPAVNHLAVHTEDHPLEYGGFEGVIPKGEYGAGRVVIWDSGTYDAEK
FQDDEVIVNLHGRKISGRYALIQTEGDQWLAHRMKDQNVFDFDTIAPMLATHGSVSALKA
SQWAFEGKWDGYRLLVEADHGTLRVRSRRGREVTGEYRELRSLAKALEEHHAVLDGEAVV
LDKRGVPNFHEMQNRGKSARVEFWAFDLLYLDGRSLLRARYRDRRKLLEMLASGGDLTVP
ELLPDDGDQALRQSAERGWEGVIAKRRDSTYQPGRRSSSWIKDKHWNTQEVVIGGWKAGE
GGRSSGIGSLLMGIPGPGGLHFAGRVGTGFTERDLANLKKTLAPLRTDQSPFDAPLPRSE
AKGVTFVEPVLVGEVRYSEWTPDDRLRQSSWRGLRPDKEASEVVRE
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgccgcgcgcttggcccgctgagccgacagcgacgccgcgggtgaaactgacc
aacgccgacaaggtgctctatcccgcgacgggaaccaccaaagccgacgtcttcgactac
tacacgcggatcgccgacgtgatgatcccgcacatcgccgggcgtccggtcacccggaag
cgctggcccaacggcgtcgatcaggaatcgttcttcgagaagcagctggcctcctcggca
ccggactggctgccgcgcgccagcgtgacccaccgatccggcacgacgacctatccgatc
atcgacagcgccaccggcctggcctggatcgcccagcaggcggcgctggaggtgcacgtg
ccgcagtggcggttcgtcgcggagtggacccgaagccgggccgaagaactcaaacccggc
ccggcgactcgactggtgttcgaccttgacccgggcgaaggcgtgacgatggcccagctc
gccgaggtggcgcgcgccgtccgcgacctgatcgatgggatcgggctgcagacgtttccg
ctcaccagcggcagcaagggactgcacctgtacacgccgctgacggagccggtgagcagc
aaaggcgccaccgtgctggccaaacgcgttgcgcagcaactggaaaagactatgccgaag
ctggtcacgtcgaccatgaccaagagcctgcgggcgggaaagatctttgtggactggagc
cagaacaacggctccaagacgaccatcgcgccctattcgctgcgcgggcgcgaccacccc
accgtcgccgcgccgcgcacctgggacgaactcgacgacccggcgctgcgtcacctgcgc
tacgacgaagtgctgacccgggtcgcccgcgacggtgacctgctcgccgagctggacgcc
tccgacaaccagacaccggtgccggaccgcctgaccaaataccgcagcatgcgcgacgcc
tccaaaacgcccgagccggttccggccgcgaaacctgctgcgggacgaggcaataccttc
gtcatccaagagcaccacgcccggcggctgcactacgacttccggctggagcgcgacggg
gtgctggtgtcctgggcggtgccgaagaacctgcccgacacccccgcggtgaatcacctg
gccgtacacaccgaggatcacccgctggaatacggcgggttcgagggcgtcatccccaaa
ggcgaatacggggcgggcagggtggtcatctgggactccggaacctatgacgccgagaag
ttccaggacgacgaggtgatcgtcaacctgcacggccgcaagatctccgggcgctacgcg
ctgatccagaccgagggcgaccaatggctggcgcaccggatgaaggaccagaacgtcttc
gacttcgacacgatcgccccgatgctcgccacccacggttcggtgtcggcgctcaaggcg
agccagtgggcgttcgagggcaaatgggacggctaccggctactggtcgaggccgaccac
ggcaccctgcgggtgcggtcccggcgcggtcgcgaagtcaccggtgagtaccgcgaatta
cgctcgctggcaaaggctctcgaggagcaccacgcggtgctcgacggcgaggccgtggtg
ctggacaagcgcggcgtgcccaacttccacgagatgcaaaaccgcggcaagagcgcgcgg
gtcgaattctgggcgttcgacctgctctacctcgacggccgctcgctgctgcgggcccgc
taccgcgatcggcgaaaactgttggaaatgctggcctccggcggtgatctgaccgttccc
gagctgctgcccgacgacggcgaccaagcgctgcggcagtccgccgagcgcggttgggag
ggcgtgatcgccaagcggcgcgactccacctatcagccgggccggcgctcgtcctcctgg
atcaaggacaagcattggaacacccaggaagtcgtgatcggcggctggaaggccggggaa
ggcggacgcagcagcggcatcggttccctgctgatgggcattccgggcccgggcggcctg
cacttcgccggccgtgtcggcaccgggttcaccgaacgcgacctggccaacttgaagaag
acgctggccccgctgcgcaccgaccaatcgcccttcgatgcgccgcttccccgcagcgag
gccaagggcgtcacgttcgtcgagccggtgctggtgggcgaggtgcgctacagcgagtgg
acaccggatgaccggctgcgccaatcgagttggcgcgggctgcggccggacaaggaggca
agcgaggtggtacgcgagtga

DBGET integrated database retrieval system