KEGG   Mycobacterium avium subsp. avium DJO-44271: NF84_14150Help
Entry
NF84_14150        CDS       T03430                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mavd  Mycobacterium avium subsp. avium DJO-44271
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AIV25616
LinkDB All DBs
Position
3072645..3073643
Genome map
AA seq 332 aa AA seqDB search
MTDFAALPDSVRAALRDEPVPQWCSPTLATLTEQRFSDPHWIFERKFDGMRCLAFRDGDR
VRLLSRNRKPLNGTYPELVEALAAQRETRFVLDGEVVAFEGRRTSFARLQGRLGITDPDV
ARASSVRIYYYVFDLLHLDGKSTVAVPLIWRKRLLRKAIDFTDPLRYAPHRVGDGMAAYR
AACGRGDEGVIAKRAESAYDGRRSENWLKFKCVRDQEFVVGGYTSPKGKRLELGALLLGY
YQGDQLRYAGKVGTGFDEATLHRLHQLLSGIACDTTPFTRSLVPEAGAHWVRPELVVQIG
FTEWTRDGKLRHPRYLGIRTDKDPTEVIRETR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacttcgccgcgctgcccgattccgtgcgtgccgcgctgcgcgacgagcccgtg
ccccagtggtgctcgcccacgctggccaccctcaccgagcagcgattctccgacccgcac
tggatcttcgagcgcaagttcgacggcatgcgctgcctggccttccgcgacggcgaccgg
gtccggctgctgtcgcgaaaccgcaagccgctcaacgggacctacccggaattggtggag
gcgctggccgcgcagcgcgagacgcgcttcgtgctggacggcgaggtggtggcgttcgag
ggccgccgcaccagcttcgcccggttgcagggccggctgggcatcaccgaccccgacgtg
gcccgggcatcgtcggtgcgtatctactactacgtgttcgacctgctgcatctcgacggc
aagtcgaccgtcgcggtgccgctgatctggcgtaagagattgctgcgcaaggcaatcgac
ttcaccgatccgctgcgctatgcaccgcaccgggtcggggacgggatggccgcgtaccgg
gcggcgtgcggtcgtggtgacgagggtgtgatcgccaagcgggccgaatcggcctatgac
ggccgccgctcggagaactggttgaagttcaaatgcgtgcgcgaccaggaattcgtggtc
ggcggctacaccagccccaagggcaagcggctcgagttgggcgccctgctgctgggctac
taccagggggaccagttgcgctacgccggcaaggtgggcaccggtttcgacgaggcgacg
ctacaccgcttgcaccagctgctgtccgggatcgcttgcgacacaacgccgttcacccgg
agtttggtgcccgaggccggcgcgcactgggtgcgcccggagcttgtggtccagatcggg
ttcaccgagtggacccgcgacggaaagctacgtcacccccgctatctcggcatccgcacc
gacaaggatcccaccgaggtgatccgggagacgcgctga

DBGET integrated database retrieval system