KEGG   Mycobacterium avium subsp. avium DJO-44271: NF84_15725Help
Entry
NF84_15725        CDS       T03430                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mavd  Mycobacterium avium subsp. avium DJO-44271
Pathway
mavd00250  Alanine, aspartate and glutamate metabolism
mavd00280  Valine, leucine and isoleucine degradation
mavd00410  beta-Alanine metabolism
mavd00640  Propanoate metabolism
mavd00650  Butanoate metabolism
mavd01100  Metabolic pathways
mavd01120  Microbial metabolism in diverse environments
Module
mavd_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mavd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NF84_15725
   00650 Butanoate metabolism
    NF84_15725
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NF84_15725
   00280 Valine, leucine and isoleucine degradation
    NF84_15725
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NF84_15725
Enzymes [BR:mavd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NF84_15725
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     NF84_15725
Amino acid related enzymes [BR:mavd01007]
 Aminotransferase (transaminase)
  Class III
   NF84_15725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIV25883
LinkDB All DBs
Position
3451677..3453026
Genome map
AA seq 449 aa AA seqDB search
MARLEQTRRLVTEIPGPASLELSKRRAAAVSHAVNVSVPVFVARAGGGIVEDVDGNRLID
LGSGIAVTTIGNSAPRVVDAVRAQVAEFTHTCFMVTPYESYVAVAETLNRITPGAGEKRS
VLFNSGAEAVENAVKVARAYTRKPAVVAFDHAYHGRTNLAMALTAKSMPYKGGFGPFAPE
IYRAPLSYPYRDGLLDKELATDGEKAAARAINIIDGQIGADSLAAVIIEPIQGEGGFIVP
AEGFLPTLLDWCRRNDVLFIADEVQTGFARSGAMFACEHEGPNGLEPDLICTAKAIADGL
PLSAVTGRAQIMDAPHVGGLGGTFGGNPLACAAALATIETIESDGLIERARQLERLITEP
LLRLQARDDRIGDVRGRGAMIAIELVKSGTAEPDKDLTQRLSVAAHAAGVIVLTCGMFGN
IIRLLPPLTISDELLAEGIDILGGLLADL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggccaggctcgagcagactcgccgactggtcaccgagatccccggcccggcgtcgctg
gaactgagcaaacgccgcgcggccgcggtgtcgcacgcggtgaacgtctcggtgccggtg
ttcgtcgcccgcgccggcggcggcatcgtcgaggacgtcgacggcaaccggctcatcgac
ctcggctccggcatcgcggtgaccaccatcggcaattcggcgccccgggtggtcgacgcg
gtgcgcgcccaggtggccgagttcacccacacctgcttcatggtgacgccgtacgagtcc
tacgtcgccgtcgccgaaacgctcaaccggatcacccccggggccggtgaaaagcgctcg
gtgctgttcaactccggcgccgaggccgtcgagaacgccgtcaaggtcgcccgcgcctac
acccgtaagccggccgtggtggccttcgaccacgcctaccacggccgcaccaacctggcg
atggcgctgaccgcgaagtcgatgccctacaagggcggcttcggcccgttcgcgccggag
atctaccgggcgccgctgtcctacccctaccgggacgggctgctcgacaaggaactggcc
accgacggggagaaggccgccgcgcgggccatcaacatcatcgacggccagatcggcgcc
gacagcctggccgcggtgatcatcgaaccgatccagggcgagggcgggttcatcgttccc
gccgagggattcctgcccaccctgctggactggtgccgccgcaacgacgtgctgttcatc
gccgacgaggtgcagaccgggttcgcgcggtccggcgccatgttcgcctgcgagcacgag
ggcccgaatggtttagagccggacctgatctgcaccgccaaggccatcgccgacgggctg
ccgctgtcggcggtcaccggccgcgcccagatcatggacgccccgcacgtcgggggcctg
ggcggcaccttcggcggcaacccgctggcgtgcgcggcggcgctggccaccatcgagacg
atcgagagcgacggcctgatcgaacgggcccggcagctggaacgcctgatcaccgaaccg
ctgctgcgcctgcaggcccgcgacgaccggatcggcgacgtccgcggccggggcgccatg
atcgccatcgaactggtgaagtccggcaccgccgagccggacaaggacctgacccagcgg
ctgtccgtcgccgcgcacgcggccggcgtcatcgtgctcacctgcggcatgttcggcaac
atcatccggctgctgccgccgctgaccatcagcgacgagctgctcgccgagggcatcgac
attctcggcgggttgttggccgacctgtaa

DBGET integrated database retrieval system