KEGG   Mycobacterium avium subsp. paratuberculosis E1: RC58_01170Help
Entry
RC58_01170        CDS       T03787                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mavi  Mycobacterium avium subsp. paratuberculosis E1
Pathway
mavi00500  Starch and sucrose metabolism
mavi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RC58_01170
Enzymes [BR:mavi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RC58_01170
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     RC58_01170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AJK73791
UniProt: A0A202FPG7
LinkDB All DBs
Position
complement(275703..277475)
Genome map
AA seq 590 aa AA seqDB search
MNDAREAVEHHPEEGSHVQDGVVEHPEAEDFDNAAALPTDPTWFKHAVFYEVLVRAFFDA
NADGAGDLRGLLAQLDYLQWLGIDCIWLPPFYDSPLRDGGYDIRDFYKVLPEFGTVEDFV
ALLNAAHERGIRVITDLVMNHTSESHPWFQESRHDPDGPYGDFYVWSDTSDRYADARIIF
VDTEESNWTFDPVRRQFYWHRFFSHQPDLNYDNPAVQEAMIDVIRFWLGLGIDGFRLDAV
PYLFEREGTNCENLPETHAFLKRVRKVVDDEFPGRVLLAEANQWPADVVEYFGDPSTGGD
ECHMAFHFPLMPRIFMAVRRESRFPISEILAQTPQIPEMAQWGIFLRNHDELTLEMVTDE
ERDYMYAEYAKDPRMKANVGIRRRLAPLLDNDRNQIELFTALLLSLPGSPVLYYGDEIGM
GDVIWLGDRDGVRTPMQWTPDRNAGFSKANPGRLYLPPSQDPVYGYQAVNVEAQRDTSTS
LLNFTRTMLAVRRRHEAFAIGTFEELGGSNPSVLAFVRQVSNDGDTVLCVNNLSRFPQPI
ELNLQHWSGCIPVELTGHVEFPRIGHLPYLLTLPGHGFYWFQLTACEEDT
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgcaagagaagctgtcgaacaccatcccgaggaaggcagtcacgtccaggac
ggtgtcgtcgagcaccccgaggccgaggacttcgacaacgccgccgcgctgcccaccgac
ccgacgtggttcaagcacgccgtgttctacgaggtgctggtccgcgcgttcttcgacgcc
aacgccgacggcgccggcgacctgcgcggtctgctggcgcagctggactacctgcagtgg
ctgggcatcgactgcatctggctgcccccgttctacgactcgccgctgcgcgacggcggt
tacgacatccgggatttctacaaggtgctgccggagttcggcacggtcgaggatttcgtg
gcgctgctcaacgccgcgcacgagcggggcatccgggtgatcaccgacctggtgatgaat
cacacgtcggagtcgcacccctggttccaggagtcccggcacgaccccgacggaccgtac
ggcgacttctacgtgtggagcgacaccagcgaccgctacgccgatgcccgcatcatcttc
gtcgacaccgaggagtccaactggacgttcgacccggtgcgccgccagttttactggcac
cggttcttctcccaccagcccgacctgaactacgacaacccggccgtgcaggaagccatg
atcgacgtgatccggttctggctcgggctgggaatcgacgggttccggctggacgcggtg
ccctacctgttcgagcgggagggcaccaactgcgagaacctgccggagacgcacgccttc
ctcaagcgggtccgcaaggtcgtcgacgacgagttcccgggccgggtgttgctggccgag
gccaaccagtggccggccgacgtggtcgagtatttcggcgaccccagcaccggcggcgac
gaatgccacatggcgttccacttcccgctgatgccgcgcatcttcatggccgtgcgccgc
gagtcgcgattcccgatctcggagatcctggcccagacgccgcagatccccgagatggcg
cagtgggggatcttcctgcgcaaccacgacgagttgacgctggagatggtcaccgacgaa
gagcgcgactacatgtacgccgagtacgccaaggatccgcggatgaaggccaacgtcggc
atccgccgccggctggcgccgctgctggacaacgaccgcaaccagatcgagctgttcacc
gccctgctgctgtccctgcccggctcgccggtgctctactacggcgacgagatcggcatg
ggcgacgtgatctggctgggggatcgcgacggggtgcgcacgccgatgcagtggacgccg
gaccgcaacgccggcttctccaaggccaaccccggccggctgtatctgccacccagccag
gacccggtgtacggctaccaggcggtcaacgtggaggcgcaacgcgacacctcgacgtcg
ctgctcaacttcacccgcaccatgctcgccgtgcggcgccggcacgaggccttcgcgatc
ggcacgttcgaggagctcggcggatccaacccgtcggtgctggcgttcgtgcggcaggtg
tccaacgacggggacaccgtgctgtgcgtcaacaacctgtcgcggttcccgcagccgatc
gagctgaatctgcagcactggagcgggtgcatcccggtcgagctgaccgggcacgtggaa
ttcccccgcatcgggcacctgccctacctgctgacgctgccggggcacggtttctattgg
ttccagctgaccgcatgcgaggaggacacatga

DBGET integrated database retrieval system