KEGG   Mycobacterium avium subsp. paratuberculosis E1: RC58_02680Help
Entry
RC58_02680        CDS       T03787                                 

Gene name
katE
Definition
(GenBank) hydroperoxidase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mavi  Mycobacterium avium subsp. paratuberculosis E1
Pathway
mavi00380  Tryptophan metabolism
mavi00630  Glyoxylate and dicarboxylate metabolism
mavi01110  Biosynthesis of secondary metabolites
mavi01130  Biosynthesis of antibiotics
mavi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RC58_02680 (katE)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    RC58_02680 (katE)
Enzymes [BR:mavi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     RC58_02680 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase_C Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AJK74049
UniProt: A0A200GV78
LinkDB All DBs
Position
complement(610568..612688)
Genome map
AA seq 706 aa AA seqDB search
MATDHTSGAPDPKQRDLESARFRRDTGYLTTQQGVRVDHTDDALTVGERGPTLLEDFHAR
EKITHFDHERIPERVVHARGAGAYGYFEPYDDRLAQYTAAKFLTSPGTRTPVFVRFSTVA
GSRGSADTVRDVRGFATKFYTEQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPHNEIP
QAQSAHDTLWDFVSLQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFRLVNARGEGTFVK
FHWKPRLGVHSLIWDECQKIAGKDPDYNRRDLWEAIESRQYPEWELGVQLVAEDDEFSFD
FDLLDATKIIPEEQVPVLPVGKMVLNRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQF
RNFSYLDTQLIRLGGPNFAQLPVNRPVAQVRTNQHDGYGQHTIPQGRSSYFKNSIGGGCP
ALADEDVFRHYTQRVDGQTMRKRAEAFQNHYGQARMFFKSMSPVEAEHIVAAFAFELGKV
EMPEIRSAVVAQLARVDDQLAAQVAAKLGLPEPPEEQVDESAPVSPALSQVTDGGDTIAS
RRIAVLAADGVDVVGTQRFTELMEQRGAVVEVLAPVAGGTLAGGSGGELRVDRSFTTMAS
VLYDAVVVACGPRSVSTLSDDGYAVHFVTEAYKHLKPIGAYGAGVDLLRKAGIDNRLAED
TDVLNDQAVVTTKAAADELPERFAEEFAAALAQHRCWQRRTDAVPA
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaccacacttcgggtgcgcccgatcccaagcagcgcgatctggagtccgcg
cggttccgccgcgacaccggatacctgaccacgcagcagggcgtgcgcgtcgaccacacc
gacgatgcgctcaccgtcggcgagcggggtccgacgctgctggaggatttccacgcccgg
gagaagatcacccacttcgaccacgagcgcatcccggagcgtgtggtgcatgcgcgcggg
gccggcgcctacggctatttcgaaccgtacgacgaccggttggcgcagtacacggcggcg
aaatttctgacctcgccgggcaccaggacgccggtgttcgtgcgtttttcgacggtcgcc
ggatcgcgcggttcggccgacaccgtccgcgacgtgcgcgggttcgccaccaagttctat
accgaacaaggcaattacgacttggtgggcaacaacttcccggtgttcttcatccaggac
ggcatcaagttccccgacttcgtgcacgcggtgaaacccgagccgcacaacgagattccg
caggcgcagtcggcgcacgacacgctgtgggacttcgtgtcgctgcagcccgagacgttg
cacgccatcatgtggctgatgtcggaccgggcgctgccgcgcagctaccgcatgatgcag
gggttcggggtgcacaccttccggctggtgaacgcccgcggcgaggggactttcgtgaag
ttccactggaagccccgactcggcgtgcactcgctgatctgggacgaatgccagaagatc
gccggcaaagaccccgattacaaccgccgcgacctgtgggaggccatcgaatcccgccag
tacccggagtgggagctgggcgtgcagctggtcgccgaggacgacgagttcagcttcgac
ttcgatctgctggacgcgacgaaaatcattccggaagaacaggttccggtattgccggtg
ggcaagatggtgttgaaccgcaaccccgacaacttcttcgccgagaccgagcaggtcgct
tttcacaccgccaacgtggtgccgggcatcgatttcaccaacgacccgttgctgcagttc
cgcaacttctcctatctggacacgcagctgatccggttgggcggccccaacttcgcgcag
ctgccggtcaaccgcccggtggcgcaggtgcggaccaaccagcacgacggttacgggcag
cacacgattccgcagggccggtccagttacttcaagaacagcatcggcggcggttgtccc
gcactggccgacgaggacgtgttccggcactacacccagcgggtggacgggcagacgatg
cgcaagcgcgccgaggcgttccagaaccactacggccaggcgcggatgttcttcaagagc
atgtcgccggtggaggccgaacacatcgtggccgccttcgccttcgaactcggcaaggtg
gagatgcccgaaatccgttccgcggtggtggcacaactcgcccgcgtcgatgaccagctg
gccgcccaggtcgcggcgaaactggggctgcccgagccgccggaggagcaggtggacgag
tcggcaccggtttccccggcgctttcgcaggtcaccgacggcggcgacaccatcgcgtcg
cgccggatcgcggtgctggccgccgacggcgtcgacgtggtgggcacgcaacgcttcacc
gagctgatggagcagcgcggcgcggtggtcgaggtgctggccccggtggccggcggcacg
ctggcgggtgggtccggcggcgagctgcgggtggaccggtccttcacgacgatggcgtcg
gtgctctacgacgcggtggtggtggcgtgcggaccgcggtcggtgtcgacgctgtccgac
gacggctacgccgtgcacttcgtcaccgaggcctacaaacacctcaagccgatcggcgcc
tacggggccggtgtcgacctgctccgcaaggccggcatcgacaaccggctcgccgaggac
accgacgtgctcaacgaccaagcggtggtcaccaccaaggccgccgccgacgagctgccc
gagcgcttcgccgaggaattcgccgccgcgctcgcgcagcaccggtgctggcagcggcgc
accgacgcggtgccggcctga

DBGET integrated database retrieval system