KEGG   Mycobacterium avium subsp. paratuberculosis E1: RC58_07375Help
Entry
RC58_07375        CDS       T03787                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
mavi  Mycobacterium avium subsp. paratuberculosis E1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AJK74866
UniProt: A0A200GZX7
LinkDB All DBs
Position
complement(1565052..1566518)
Genome map
AA seq 488 aa AA seqDB search
MTKNSDHRCYDELFIGGQWRKPANPQQLDVISPHSEQPIGHAQAAGPEDVDAAVAAARRA
FDHGPWPRMSHAERMAKIEQLATIYAAHMDEMADLITDEMGSPRSFSRMGQGAAAATLIH
LTLAAARDFPWTERRQGVLGEVHLHRAPVGVVGAIVPWNVPQFLIMPKLIPALIAGCTVI
VKPAPETPLDALWLAEMIEQLELPQGVVSVLPGGTDVGEALVRHPGVDKIAFTGSSAVGR
RIAALCGERLKRVSLELGGKSAAIILDDADIDKTVAGLKSAGLMNNGQACVAQTRILVSD
RKHDEVVDALAAMMAELNVGDPADESTDIGPLVAQRQQRRVQEYIKSGRSEGARMVLGGE
DSPAGRGWYVRPTLFADATNDMRIAREEIFGPVLTVLRYRDEDDAIRIANETDYGLAGSV
WTADVAHGLEVAAAVRTGTYGINMYTLDIGAPFGGFKQSGIGREFGPEGLHEYVELQTLV
CKGQLPPL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagaattccgaccatcgttgctacgacgaactgttcatcggcgggcagtggcga
aagccggccaatccgcagcagctcgacgtgatctcgccgcactccgagcagccgatcggc
cacgcccaggcggccggtcccgaggacgtcgacgccgccgtcgccgccgcccgccgggcc
ttcgatcacggcccatggccgcggatgagccatgccgagcggatggccaagatcgaacag
ctcgccacgatctacgccgcgcacatggacgagatggccgacctgatcaccgacgagatg
gggtcgccgcgcagcttcagccggatgggtcagggagcggccgccgcgacgctgatccac
ctcacgctggccgccgcccgggactttccctggaccgaacgccgccagggcgtgctcggc
gaggtgcacctgcaccgggccccggtcggggtggtgggcgcgatcgtgccgtggaacgtg
ccgcagttcctgatcatgcccaaactgatcccggcgctcatcgcggggtgcacggtgatc
gtgaaaccagcacccgaaacccctttggacgctttatggttggccgagatgatcgagcag
ctggagctgccgcagggcgtggtgtcggtgcttcccggcggcaccgacgtgggcgaggcg
ctggtgcgccacccgggggtggacaagatcgcgttcaccggctcgagtgccgtggggcgc
cggatcgccgccctgtgcggggagcggctcaagcgggtgagcctggagttgggcggcaag
tcggcggcgatcatcctcgacgacgccgacatcgacaagaccgtcgccggcctgaagagt
gcggggctgatgaacaacgggcaggcctgcgtcgcccagacccgcatcctggtcagcgac
cgcaagcacgacgaggtcgtcgacgcactggccgccatgatggcggagctgaatgtcggc
gatccggccgatgagtcgacggacatcggaccgcttgtcgcccaacggcaacagcgccgg
gtccaggagtacatcaagtccggccgcagtgagggggcccgcatggtgctcggcggcgag
gacagtccggccgggcgcggctggtatgtgcggccgacgctgttcgccgacgccaccaac
gacatgcgtatcgcccgggaggagattttcggcccggtgttgaccgtcttgcgttaccgc
gacgaggacgacgctatccgcatcgccaacgaaaccgattacggcctggccggttcggtg
tggacggccgacgtcgcccacggcctcgaggtcgccgccgcggttcgcaccggcacgtac
ggcatcaacatgtacaccctggacatcggcgccccgttcggtggattcaagcaatccggc
atcgggcgggagttcggtcccgaggggctacacgagtacgtcgagcttcagacgctcgtg
tgcaaggggcagctgccgccgctgtga

DBGET integrated database retrieval system