KEGG   Mycobacterium avium subsp. avium 2285 (R): LA63_01700Help
Entry
LA63_01700        CDS       T03342                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mavr  Mycobacterium avium subsp. avium 2285 (R)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AIR54791
LinkDB All DBs
Position
complement(333752..334861)
Genome map
AA seq 369 aa AA seqDB search
MDLPVMPPVSPMLAKSVGAIPPAASYEPKWDGFRSICFRDGDEVELGSRNERPMTRYFPE
LVAAVRAELPQRCVIDGEIVIATDHGLDFEALQQRIHPAESRVRMLAEATPASFIAFDLL
ALGDEDYTGRPFRERRAALLEAVGGPGPSIHVTPATTDLDTARRWFDEFEGAGLDGVVAK
PLDITYQPDKRVMFKIKHERTADCVVAGYRVHKSGADAIGSLLLGLYQDDGQLASVGVIG
AFPMAERRRLFTELQPLVTDFEDHPWNWAAHQAGERTPRKNEFSRWNAGKDLSFVPLRPE
RVVEVRYDHMEGRRFRHTAQFNRWRPDRDPRSCTYEQLEQPVTFRLGDIVPGLGASRADH
KPGKQIGAP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggaccttcctgtcatgccgccggtgtcgccgatgctggcgaagtcggtcggcgcgatt
cccccggccgcgtcgtatgagcccaagtgggacggcttccggtcgatctgtttccgcgac
ggcgacgaggtcgagttgggcagccgcaacgagcggccgatgacgcgctacttccccgaa
ttggtggcggcggtgcgggcggagctgccgcagcgctgcgtgatcgacggggagatcgtc
atcgccaccgaccacggcctggacttcgaggcgctgcaacaacgcatccatccggccgag
tcgcgggtgcggatgctggccgaggccacgccggcgtcgttcatcgccttcgacctgctg
gcgctgggcgacgaggactacaccggccggccgttccgcgagcggcgcgcggcgctgctg
gaggcggtgggcggtccggggccctcgatccatgtcacgccggcgaccaccgatctggac
accgcgcggcggtggttcgacgaattcgagggcgccgggctcgacggtgtggtcgccaag
ccgttggatatcacctatcagccggacaagcgggtgatgttcaagatcaaacacgagcgg
acggccgactgtgtggtggccggttatcgggtgcacaagtccggggcggacgcgatcggc
tcgttgttgctggggctgtatcaggatgacggccagctcgcgtcggtcggcgtgatcggc
gccttcccgatggccgagcggcggcggctgttcaccgaattacagccgctggtcaccgat
ttcgaggaccacccgtggaactgggccgcgcaccaggccggcgagcgcacgccccgcaag
aacgagttctcgcgctggaacgccggcaaggacctctcgttcgtcccgctgcggcccgag
cgggtggtcgaggtccgctatgaccacatggagggccggcgattccgtcataccgcgcag
ttcaatcgatggcggccggaccgcgacccacgctcctgcacctacgaacagctcgagcag
ccggtgacgttccgcctgggcgacatcgtgccgggcctcggcgcgagccgcgcagatcac
aagcccggcaagcagattggggctccatag

DBGET integrated database retrieval system