KEGG   Mycobacterium avium subsp. avium 2285 (R): LA63_14305Help
Entry
LA63_14305        CDS       T03342                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mavr  Mycobacterium avium subsp. avium 2285 (R)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AIR57131
LinkDB All DBs
Position
3047394..3048392
Genome map
AA seq 332 aa AA seqDB search
MTDFAALPDSVRAALRDEPVPQWCSPTLATLTEQRFSDPHWIFERKFDGMRCLAFRDGDR
VRLLSRNRKPLNGTYPELVEALAAQRETRFVLDGEVVAFEGRRTSFARLQGRLGITDPDV
ARASSVRIYYYVFDLLHLDGKSTVAVPLIWRKRLLRKAIDFTDPLRYAPHRVGDGMAAYR
AACGRGDEGVIAKRAESAYDGRRSENWLKFKCVRDQEFVVGGYTSPKGKRLELGALLLGY
YQGDQLRYAGKVGTGFDEATLHRLHQLLSGIACDTTPFTRSLVPEAGAHWVRPELVVQIG
FTEWTRDGKLRHPRYLGIRTDKDPTEVIRETR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacttcgccgcgctgcccgattccgtgcgtgccgcgctgcgcgacgagcccgtg
ccccagtggtgctcgcccacgctggccaccctcaccgagcagcgattctccgacccgcac
tggatcttcgagcgcaagttcgacggcatgcgctgcctggccttccgcgacggcgaccgg
gtccggctgctgtcgcgaaaccgcaagccgctcaacgggacctacccggaattggtggag
gcgctggccgcgcagcgcgagacgcgcttcgtgctggacggcgaggtggtggcgttcgag
ggccgccgcaccagcttcgcccggttgcagggccggctgggcatcaccgaccccgacgtg
gcccgggcatcgtcggtgcgtatctactactacgtgttcgacctgctgcatctcgacggc
aagtcgaccgtcgcggtgccgctgatctggcgtaagagattgctgcgcaaggcaatcgac
ttcaccgatccgctgcgctatgcaccgcaccgggtcggggacgggatggccgcgtaccgg
gcggcgtgcggtcgtggtgacgagggtgtgatcgccaagcgggccgaatcggcctatgac
ggccgccgctcggagaactggttgaagttcaaatgcgtgcgcgaccaggaattcgtggtc
ggcggctacaccagccccaagggcaagcggctcgagttgggcgccctgctgctgggctac
taccagggggaccagttgcgctacgccggcaaggtgggcaccggtttcgacgaggcgacg
ctacaccgcttgcaccagctgctgtccgggatcgcttgcgacacaacgccgttcacccgg
agtttggtgcccgaggccggcgcgcactgggtgcgcccggagcttgtggtccagatcggg
ttcaccgagtggacccgcgacggaaagctacgtcacccccgctatctcggcatccgcacc
gacaaggatcccaccgaggtgatccgggagacgcgctga

DBGET integrated database retrieval system