KEGG   Mycobacterium avium subsp. avium 2285 (R): LA63_15870Help
Entry
LA63_15870        CDS       T03342                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mavr  Mycobacterium avium subsp. avium 2285 (R)
Pathway
mavr00250  Alanine, aspartate and glutamate metabolism
mavr00280  Valine, leucine and isoleucine degradation
mavr00410  beta-Alanine metabolism
mavr00640  Propanoate metabolism
mavr00650  Butanoate metabolism
mavr01100  Metabolic pathways
mavr01120  Microbial metabolism in diverse environments
Module
mavr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mavr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LA63_15870
   00650 Butanoate metabolism
    LA63_15870
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LA63_15870
   00280 Valine, leucine and isoleucine degradation
    LA63_15870
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LA63_15870
Enzymes [BR:mavr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LA63_15870
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     LA63_15870
Amino acid related enzymes [BR:mavr01007]
 Aminotransferase (transaminase)
  Class III
   LA63_15870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIR57430
UniProt: X8AWD7
LinkDB All DBs
Position
3401646..3402995
Genome map
AA seq 449 aa AA seqDB search
MARLEQTRRLVTEIPGPASLELSKRRAAAVSHAVNVSVPVFVARAGGGIVEDVDGNRLID
LGSGIAVTTIGNSAPRVVDAVRAQVAEFTHTCFMVTPYESYVAVAETLNRITPGAGEKRS
VLFNSGAEAVENAVKVARAYTRKPAVVAFDHAYHGRTNLAMALTAKSMPYKGGFGPFAPE
IYRAPLSYPYRDGLLDKELATDGEKAAARAINIIDGQIGADSLAAVIIEPIQGEGGFIVP
AEGFLPTLLDWCRRNDVLFIADEVQTGFARSGAMFACEHEGPNGLEPDLICTAKAIADGL
PLSAVTGRAQIMDAPHVGGLGGTFGGNPLACAAALATIETIESDGLIERARQLERLITEP
LLRLQARDDRIGDVRGRGAMIAIELVKSGTAEPDKDLTQRLSVAAHAAGVIVLTCGMFGN
IIRLLPPLTISDELLAEGIDILGGLLADL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggccaggctcgagcagactcgccgactggtcaccgagatccccggcccggcgtcgctg
gaactgagcaaacgccgcgcggccgcggtgtcgcacgcggtgaacgtctcggtgccggtg
ttcgtcgcccgcgccggcggcggcatcgtcgaggacgtcgacggcaaccggctcatcgac
ctcggctccggcatcgcggtgaccaccatcggcaattcggcgccccgggtggtcgacgcg
gtgcgcgcccaggtggccgagttcacccacacctgcttcatggtgacgccgtacgagtcc
tacgtcgccgtcgccgaaacgctcaaccggatcacccccggggccggtgaaaagcgctcg
gtgctgttcaactccggcgccgaggccgtcgagaacgccgtcaaggtcgcccgcgcctac
acccgtaagccggccgtggtggccttcgaccacgcctaccacggccgcaccaacctggcg
atggcgctgaccgcgaagtcgatgccctacaagggcggcttcggcccgttcgcgccggag
atctaccgggcgccgctgtcctacccctaccgggacgggctgctcgacaaggaactggcc
accgacggggagaaggccgccgcgcgggccatcaacatcatcgacggccagatcggcgcc
gacagcctggccgcggtgatcatcgaaccgatccagggcgagggcgggttcatcgttccc
gccgagggattcctgcccaccctgctggactggtgccgccgcaacgacgtgctgttcatc
gccgacgaggtgcagaccgggttcgcgcggtccggcgccatgttcgcctgcgagcacgag
ggcccgaatggtttagagccggacctgatctgcaccgccaaggccatcgccgacgggctg
ccgctgtcggcggtcaccggccgcgcccagatcatggacgccccgcacgtcgggggcctg
ggcggcaccttcggcggcaacccgctggcgtgcgcggcggcgctggccaccatcgagacg
atcgagagcgacggcctgatcgaacgggcccggcagctggaacgcctgatcaccgaaccg
ctgctgcgcctgcaggcccgcgacgaccggatcggcgacgtccgcggccggggcgccatg
atcgccatcgaactggtgaagtccggcaccgccgagccggacaaggacctgacccagcgg
ctgtccgtcgccgcgcacgcggccggcgtcatcgtgctcacctgcggcatgttcggcaac
atcatccggctgctgccgccgctgaccatcagcgacgagctgctcgccgagggcatcgac
attctcggcgggttgttggccgacctgtaa

DBGET integrated database retrieval system