KEGG   Mycobacterium avium subsp. avium 2285 (R): LA63_18805Help
Entry
LA63_18805        CDS       T03342                                 

Gene name
katE
Definition
(GenBank) hydroperoxidase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mavr  Mycobacterium avium subsp. avium 2285 (R)
Pathway
mavr00380  Tryptophan metabolism
mavr00630  Glyoxylate and dicarboxylate metabolism
mavr01110  Biosynthesis of secondary metabolites
mavr01130  Biosynthesis of antibiotics
mavr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mavr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LA63_18805 (katE)
  Amino acid metabolism
   00380 Tryptophan metabolism
    LA63_18805 (katE)
Enzymes [BR:mavr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     LA63_18805 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AIR57987
LinkDB All DBs
Position
3972113..3974233
Genome map
AA seq 706 aa AA seqDB search
MATDHTSDAPDPKQRDLESARFRRDTGYLTTQQGVRVDHTDDALTVGERGPTLLEDFHAR
EKITHFDHERIPERVVHARGAGAYGYFEPYDDRLAQYTAAKFLTSPGTRTPVFVRFSTVA
GSRGSADTVRDVRGFATKFYTEQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPHNEIP
QAQSAHDTLWDFVSLQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFRLVNARGEGTFVK
FHWKPRLGVHSLIWDECQKIAGKDPDYNRRDLWEAIESGQYPEWELGVQLVAEDDEFSFD
FDLLDATKIIPEEQVPVLPVGKMVLNRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQF
RNFSYLDTQLIRLGGPNFAQLPVNRPVAQVRTNQHDGYGQHAIPQGRSSYFKNSIGGGCP
ALADEDVFRHYTQRVDGQTMRKRAEAFQNHYGQARMFFKSMSPVEAEHIVAAFAFELGKV
EMPEIRSAVVAQLARVDDQLAAQVAAKLGLPEPPEEQVDESAPVSPALSQVTDGGDTIAS
RRIAVLAADGVDVVGTQRFTELMEQRGAVVEVLAPVAGGTLAGGSGGELRVDRSFTTMAS
VLYDAVVVACGPRSVSTLSDDGYAVHFVTEAYKHLKPIGAYGAGVDLLRKAGIGNRLAED
TDVLNDQAVVTTKAAADELPERFAEEFAAALAQHRCWQRRTDAVPA
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaccacacttcggatgcgcccgatcccaagcagcgcgatctggagtccgcg
cggttccgccgcgacacgggatacctgaccacgcagcagggcgtgcgcgtcgaccacacc
gacgatgcgctcaccgtcggcgagcggggtccgacgctgctcgaggatttccacgcccgg
gagaagatcacccacttcgaccacgagcgcatcccggagcgtgtggtgcatgcgcgcggg
gccggcgcctacggctatttcgaaccgtacgacgaccggttggcgcagtacacggcggcg
aaattcctgacctcgccgggcaccaggacgccggtgttcgtgcgtttctcgacggtcgcc
ggatcgcgcggttcggccgacaccgtccgcgacgtgcgcgggttcgccaccaagttctat
accgaacaaggcaattacgacttggtgggcaacaacttcccggtgttcttcatccaggac
ggcatcaagttccccgacttcgtgcacgcggtgaaacccgagccgcacaacgagattccg
caggcgcagtcggcgcacgacacgctgtgggacttcgtgtcgctgcagcccgagacgttg
cacgccatcatgtggctgatgtcggaccgggcgctgccgcgcagctaccgcatgatgcag
gggttcggggtgcacaccttccggctggtgaacgcccgcggcgaggggactttcgtgaag
ttccactggaagccccgactcggcgtgcactcgctgatctgggacgaatgccagaagatc
gccggcaaagaccccgattacaaccgccgcgacctgtgggaggccatcgaatccggccag
tacccggagtgggagctgggcgtgcagctggtcgccgaggacgacgagttcagcttcgac
ttcgatctgctggacgctacgaaaatcattccggaagaacaggttccggtattgccggtg
ggcaagatggtgttgaaccgcaaccccgacaactttttcgccgagaccgagcaggtcgcg
ttccacaccgccaacgtggtgccgggcatcgatttcaccaacgacccgttgctgcagttc
cgcaacttctcctatctggacacgcagctgatccggttgggcggccccaacttcgcgcag
ctgccggtcaaccgcccggtggcgcaggtgcggaccaaccagcacgacggttacgggcag
cacgcgattccgcagggccggtccagttacttcaagaacagcatcggcggcggttgtccc
gcactggccgacgaggacgtgttccggcactacacccagcgggtggacgggcagacgatg
cgcaagcgcgccgaggcgttccagaaccactacggccaggcgcggatgttcttcaagagc
atgtcgccggtggaggccgaacacatcgtggctgccttcgccttcgaactcggcaaggtg
gagatgcccgaaatccgttccgcggtggtggcacaactcgcccgcgtcgatgaccagctg
gccgcccaggtcgcggcgaaactggggctgcccgagccgcccgaggagcaggtggacgaa
tcggcaccggtttccccggcgctttcgcaggtcaccgacggcggcgacaccatcgcgtcg
cgccggatcgcggtgctggccgccgacggcgtcgacgtggtgggcacgcaacgcttcacc
gagctgatggagcagcgcggcgcggtggtcgaggtgctggccccggtggccggcggcacg
ctggcgggtgggtccggcggcgagctgcgggtggaccggtccttcacgacgatggcgtcg
gtgctctacgacgcggtggtggtggcgtgcggaccgcggtcggtgtcgacgctgtccgac
gacggctacgccgtgcacttcgtcaccgaggcctacaaacacctcaagccgatcggcgcc
tacggggccggtgtcgacctgctccgcaaggccggcatcggcaaccggctcgccgaggac
accgacgtgctcaacgaccaagcggtggtcaccaccaaggccgccgccgacgagctgccc
gagcgcttcgccgaggaattcgccgccgcgctcgcgcagcaccggtgctggcagcggcgc
accgacgcggtgccggcctga

DBGET integrated database retrieval system