KEGG   Mycobacterium avium subsp. paratuberculosis E93: RE97_03835Help
Entry
RE97_03835        CDS       T03847                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mavu  Mycobacterium avium subsp. paratuberculosis E93
Pathway
mavu00473  D-Alanine metabolism
mavu00550  Peptidoglycan biosynthesis
mavu01100  Metabolic pathways
mavu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mavu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RE97_03835
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RE97_03835
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RE97_03835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mavu01011]
    RE97_03835
Enzymes [BR:mavu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RE97_03835
Peptidoglycan biosynthesis and degradation proteins [BR:mavu01011]
 Precursor biosynthesis
  Amino acid ligase
   RE97_03835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST RimK CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AJK78403
LinkDB All DBs
Position
844652..845761
Genome map
AA seq 369 aa AA seqDB search
MNASQRVRVAVVFGGRSNEHAISCVSAGSILRNLDPRRFEVVAIGITPQGSWVLTDGDPA
ALAISDRQLPEVTSASGTELALPADPGRSGQLVSLPPGASEVLASVDVVFPVLHGPYGED
GTIQGLLELAGVPYVGAGVFASAAGMDKEFTKKLFAAEGLPIGDYAVLRPSQSTLSLQDR
ERLGLPVFVKPARGGSSIGVSRVSSWDELDAAVAAARDHDPKVIVEAAIAGRELECGVLE
MPDGTVQASTVGEIRVAGVRGREDSFYDFATKYLDDTAELDVPAKVDDEIADAVRELAIR
AFKAVDCQGLARVDFFLTETGPVLNEINTMPGFTTISMYPRMWAASGVDYPSLLATMVET
ALARGVGLR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgccagccagcgggtccgcgtcgccgtcgtcttcggcgggcgcagcaacgagcac
gccatctcgtgcgtctcggccggcagcatcctgcgcaacctcgacccgcggcggttcgag
gtcgtcgcgatcggcatcaccccgcaaggctcgtgggtgctcaccgacggcgacccggcc
gcgctggcgatcagcgaccggcaactgcccgaggtgacgtccgcgtcggggaccgagctg
gcgctgccggcggatccggggcgtagcggccaactggtttcccttccccccggagccagt
gaggtgttggcctccgtcgacgtggtgttcccggtgctgcacggcccgtacggcgaggac
ggcacgatccaggggctgctcgaactcgccggggtgccctacgtgggggccggcgtgttc
gccagcgccgcgggcatggacaaggaattcaccaagaagctgttcgccgccgagggattg
ccgatcggcgactacgcggtgctgcgcccgtcgcagtccacactgtcgctgcaggaccgc
gagcggctgggcttgccggtgttcgtcaaacccgcccggggcggctcctcgatcggcgtc
agccgggtctcgagctgggacgagctggacgccgccgtggccgccgcccgcgaccacgat
cccaaggtcatcgtcgaggcggccatcgccggccgggagctggagtgcggggtgctcgaa
atgcccgacggcacagtgcaagccagcacggtcggcgagatccgggtggccggggtgcgc
gggcgtgaggactcgttctacgacttcgcaaccaaatacctcgacgacacagccgaattg
gacgtgcccgccaaggtcgatgacgaaatcgccgacgcggtacgcgaattggcgatccgc
gcattcaaggccgttgactgccaagggctggcccgggtggacttcttcctcaccgagacc
gggccggtgctcaacgagatcaacacgatgcccggcttcaccaccatctcgatgtacccg
cggatgtgggcggccagcggcgtggactacccgagtctgctggccaccatggtggagacg
gccctggcccgcggcgtcgggctgcgctag

DBGET integrated database retrieval system