KEGG   Mycobacterium avium subsp. paratuberculosis E93: RE97_12675Help
Entry
RE97_12675        CDS       T03847                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
mavu  Mycobacterium avium subsp. paratuberculosis E93
Pathway
mavu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mavu01100  Metabolic pathways
mavu01110  Biosynthesis of secondary metabolites
mavu01130  Biosynthesis of antibiotics
mavu01230  Biosynthesis of amino acids
mavu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mavu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RE97_12675
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    RE97_12675
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RE97_12675
Enzymes [BR:mavu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     RE97_12675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AJK79949
LinkDB All DBs
Position
complement(2791399..2792931)
Genome map
AA seq 510 aa AA seqDB search
MHAHLAATTSREDFRQLAAEHRVVPVTRKVLADSETPLSAYRKLAANRPGTFLLESAEHG
RSWSRWSFIGAGSPSALTVRDGEAGWLGVVPQDAPTGGDPLQALRATLDLLATGPLSGLP
PLSGGMVGFFAYDLVRRLERLPELAVDDLGLPDMLLLLATDLAAVDHHEGTITLIANAVN
WNGTDERVDEAYDDAVARLDVMTAALGQPLASTVATFERPEPRYRAQRSVEEYGKIVDYL
VEQIAAGEAFQVVPSQRFEMDTDVDPIDVYRMLRVTNPSPYMYLLHVPNDAGGTDFSIVG
SSPEALVTVADGVATTHPIAGTRWRGQTDDEDQLLEKELLADEKERAEHLMLVDLGRNDL
GRVCAPGTVRVDDYSHIERYSHVMHLVSTVTGVLDAGRTALDAVTACFPAGTLSGAPKVR
AMELIEEVEKTRRGLYGGVVGYLDFAGNADFAIAIRTALMRGGTAYVQSGGGVVADSNGP
YEYTEATNKARAVLGAIAAAETLTEPGARR
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgcccacctcgccgcgacgacctcacgagaggatttccgccagctggcagccgag
caccgcgtggtcccggtgacccgcaaggtgctggccgacagcgagacgccgctgtcggcc
taccgcaaactcgccgccaaccgcccgggcaccttcctgctggagtcggccgagcacggc
cggtcctggtcgcggtggtcgttcatcggcgccgggtcgccgtcggcgctgaccgtgcgc
gacggggaagccggctggctgggggtggtgccgcaggacgcaccgaccggcggcgatccg
ctgcaggcactgcgcgccaccctggacctgctggccaccgggccgctgagcgggctgccg
ccgttgtcgggcggcatggtcggcttcttcgcctacgacctggtgcggcgcctggagcgg
ctgcccgagctggccgtcgacgacctgggcctgccggacatgctgctgctgctggccacc
gatctggcggccgtcgaccaccacgagggcaccatcacgctgatcgccaacgcggtgaac
tggaacgggaccgacgaacgggtcgacgaggcctacgacgacgccgtcgcccggctggac
gtgatgaccgcggcgctgggccagccgctagcctccaccgtggccaccttcgagcggccc
gagccgcgctaccgcgcgcagcgcagcgtcgaggagtacggcaagatcgtcgactacctc
gtcgagcagatcgccgccggtgaggcgtttcaggtggtgccctcgcagcggttcgaaatg
gacaccgacgtcgacccgatcgacgtgtaccggatgttgcgggtcaccaaccccagcccc
tacatgtatctgctgcatgtaccgaatgatgctgggggaacggacttttcgatcgtcggg
tccagcccggaggctctggtcacggtggccgacggcgtcgcgaccacccacccgatcgcc
gggacccggtggcgcgggcagaccgacgacgaggaccagctgctggaaaaggagctgctg
gccgacgagaaggaacgcgccgagcatctgatgctggtcgatctgggccgcaacgatctg
ggccgggtgtgcgcgccgggcaccgtccgggtcgacgactacagccacatcgagcgctac
agccacgtcatgcatctggtctcgacggtgaccggcgtgctcgacgcgggcaggaccgcc
ctggacgcggtgacggcctgcttcccggccggcaccctgtcgggtgcgccgaaggtccgg
gcgatggagctgatcgaagaggtggagaagacgcgccgcggcctctacggcggcgtggtc
ggctacctggacttcgccggcaacgccgacttcgccatcgccatccgcaccgcgctgatg
cgcggcggcaccgcctacgtgcaatcgggtggcggggtggtggcggactccaacggcccc
tacgaatacaccgaggccaccaacaaggcgcgcgcggtgctcggcgcgatcgcggccgcc
gagacgctgaccgaaccgggcgcgcggcgatga

DBGET integrated database retrieval system