KEGG   Mycobacterium avium subsp. paratuberculosis E93: RE97_19640Help
Entry
RE97_19640        CDS       T03847                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mavu  Mycobacterium avium subsp. paratuberculosis E93
Pathway
mavu00220  Arginine biosynthesis
mavu00250  Alanine, aspartate and glutamate metabolism
mavu00290  Valine, leucine and isoleucine biosynthesis
mavu01100  Metabolic pathways
mavu01110  Biosynthesis of secondary metabolites
mavu01130  Biosynthesis of antibiotics
mavu01210  2-Oxocarboxylic acid metabolism
mavu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mavu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RE97_19640
   00290 Valine, leucine and isoleucine biosynthesis
    RE97_19640
   00220 Arginine biosynthesis
    RE97_19640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mavu01007]
    RE97_19640
Enzymes [BR:mavu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     RE97_19640
    2.6.1.66  valine---pyruvate transaminase
     RE97_19640
Amino acid related enzymes [BR:mavu01007]
 Aminotransferase (transaminase)
  Class I
   RE97_19640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AJK81170
LinkDB All DBs
Position
complement(4240219..4241511)
Genome map
AA seq 430 aa AA seqDB search
MDSDGTIGGVTTHQLPVHSSAHHRQQRTFAQSSKLQDVLYEIRGPVHQHAARLEAEGHRI
LKLNIGNPAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILPARRAVVTRYELVDGFPRFD
VDDVYLGNGVSELITMTLQALLDNGDEVLIPSPDYPLWTASTSLAGGTPVHYLCDETQGW
QPDIADLESKITERTKALVVINPNNPTGAVYSGEILSQMVDLARKHELLLLADEIYDKIL
YDDAKHINVASLAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKDHAGSFIEGINLLANM
RLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDVAWSKLNEIPGVSCVKPAGALYA
FPRLDPEVYDITDDEQLVLDLLLQEKILVTHGTGFNWPAPDHLRIVTLPWARDLAAAIER
LGNFLVGYRQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggacagtgatggcaccattggtggtgtgacaacccaccagctgcctgtgcactcgtcc
gcgcaccatcgccagcagcgtactttcgcccagtcgtccaagctccaggacgtcctgtac
gagatccgcggcccggtacatcagcacgcggcgcggctggaggccgagggacaccgcatc
ctcaagctcaacatcggcaacccggcgccgttcggcttcgaggcgcccgacgtcatcatg
cgcgacatgatccaggccctgccgtacgcccagggctactccgactcgcagggcatcctg
cccgcgcgccgggcggtggtcacccgctacgagttggtcgacgggttcccccgcttcgac
gtcgacgatgtctacctgggcaacggcgtgtccgaactgatcacgatgacgctgcaggcg
ctgctcgacaacggcgacgaggtgctgatcccgtcgccggactacccgctgtggacggcg
tcgacctcgctggccggcggcacccccgtgcactacctgtgcgacgagacgcagggctgg
cagcccgacatcgccgatctggaatccaagatcaccgagcgcaccaaggcgctggtggtg
atcaacccgaacaacccgaccggcgcggtgtacagcggcgaaatcctgagccagatggtc
gatctggcgcgcaagcacgagctgctgctgctggccgacgagatctacgacaagatcctc
tacgacgacgccaagcacatcaacgtggcgtcgctggcgccggacatgctgtgcctgacc
ttcaacggcctgtcgaaggcgtaccgggtggccggctaccgggccggctggctggcgatc
accggacccaaggaccacgccggcagcttcatcgagggcatcaacctgctggccaacatg
cggctgtgcccgaacgtcccggcgcagcatgcgatccaggtggccctgggcggccaccag
agcatcgaggacctggtgctgccgggcgggcggctgctcgagcagcgcgacgtggcgtgg
agcaagctcaacgagatccccggggtgtcctgcgtcaaacccgccggcgccttgtacgcg
tttccccggctggaccccgaggtctacgacatcaccgacgacgagcagctggtgctcgac
ctgctgctgcaggagaagatcctggtcacccacggcaccggcttcaactggccggcgccg
gatcacctgcgcatcgtgacgctgccgtgggcgcgggacctggccgccgcgatcgagcgg
ctgggcaacttcctggtcggctatcgacagtaa

DBGET integrated database retrieval system