KEGG   Metarhizium acridum: MAC_00018Help
Entry
MAC_00018         CDS       T03104                                 

Definition
(RefSeq) histone deacetylase HosB
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
maw  Metarhizium acridum
Brite
KEGG Orthology (KO) [BR:maw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:maw03036]
    MAC_00018
Enzymes [BR:maw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     MAC_00018
Chromosome and associated proteins [BR:maw03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     MAC_00018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C
Motif
Other DBs
NCBI-GeneID: 19244329
NCBI-ProteinID: XP_007806358
UniProt: E9DRU5
LinkDB All DBs
Position
Unknown
AA seq 1150 aa AA seqDB search
MSSSIHGSLSPRQGPTSPASNRANDDNSGLTLSLSQLSLTNEPKTLKPLPSPRNSWGTPA
KPPSRRSPSASPHPRTPSRSPSNGPGSRRASHAETPPLLRKASMNSLHSANGFAPGRPLA
RRSSSSQIISTSPANRTPPEEKPPVTAGSIASDYFAAELAEYHGDTATLSTDTVVILNDA
VYGHRFSRPRTSRSALSTIVERPERIKAAVLGISTAYVRLGGRHCQGHLPIHPKRNLSDI
ISIPFRIHKTTRQLSLLSPAVTNVHGTKWMEELKLMCGSAESILAMGGKELQRPDISRGP
EHAAPQKLHEGDLYLCEESLNAMQGALGAVCEAVDTVFGPGPRKAFVGVRPPGHHCSASH
PSGFCWVNNVHVGIMHAALEHGLTHAAIIDFDLHHGDGSQAITWQHNARANAANKSHASW
KRTSIGYFSLHDINSYPCEMGDEDKVKNASLCIDSAHGQCIWNVHLQSWKTEQEFWTLYE
STYAVLLEKTRKYLKNEAAKLRASNQVPKAAVFFSAGFDASEWESAGMQRHHVNVPTEFY
ARLSQDVVKLATEEGLAVDGRVISVLEGGYSNRALCSGILSHLSGLVGVSHDQSPIETEQ
ESTGLAYEMGQRIGAINLNADPTMKPPASMYDAAWWATNELDLLEEPEEPLAVLRKPRNS
TPPTYSSPTQASTARVADPIKMKNSLSSLSTSYSKVPQRPTSPPPPEVPWHIAAKELCKT
LIPSDRQTDSCTAEDLNAEASRARRDRQSLLIGNQPPTPSGSDRSSSRMSLRERKSRPIG
PIDEEMSEMLPKTRRKPASTPISSPAKAGRRTPQPAGAQSARRSSRRLSVASTNLSPPRE
EPPPVPPIPATAPGPNRTTSRPNSRVGRTQSSNKVPVKKSQAVPPRIDPAPKGGRDVTRA
STPARGAKQSTVGADTPTPATGLPLNAVGNDAKSDVDSLTNGVKKIRINLITKTQKDGKQ
AKSEQSAEPGRQLGQDSSIVKSEKPPTPEGMSSIPNAPEQLPTQLAPASGVPEAPPTPSL
SGGISTPVEEIYTSNASSPTPTPSIPTGSSPDVPHVTIQPASDASDVFIPYQPEGPEPVI
MGQHEHLRWLPPNVQTPSSVAPVNTPLPSATQTKSTLFHYTSGIPFAPRPDTESQGRPGS
LGTARTGHEQ
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctcgattcatgggtcgttgtctccacgacagggaccaacatcaccagcatct
aacagagcaaacgatgacaactctggtttaacactgtcgctgagccagctttccttgacg
aacgaacccaaaaccctgaagcctcttccgagcccaagaaactcctggggaactcccgcg
aagccgccatctcgaagatcgccatcagcctcacctcatcctcggacgccttctcgcagt
ccttctaatggaccgggctctagaagagcttcccatgctgagacgccgccactacttcga
aaggcttccatgaactctttacattctgcgaatggtttcgcgcctggaagacctttggcc
aggcgatcgagttcatcgcagataatctcaacatctccagcaaacaggacgccccctgaa
gagaagccccctgtgacagcaggaagcatcgctagcgattactttgcggctgaacttgcg
gaataccatggagatactgctacgctatctacggacactgttgttatccttaacgatgct
gtatatgggcatcgcttctcccgccctcgaacttcccgaagtgcattaagcacaattgtg
gaacgacccgaacgtatcaaggctgctgttctaggtatatcaacagcatacgtacggttg
ggcggtcgacactgtcagggtcacttgcctattcatcccaagaggaacctttccgacatc
atcagcattccctttcgcattcacaagaccactagacaactgtcactgctgtctcccgca
gtgaccaatgtacatggcaccaagtggatggaggaattgaaactcatgtgcggctcggct
gaatcaatattggctatgggagggaaggagctgcaacgacctgacatttctagaggacca
gaacatgctgcgccacagaagctccacgagggcgatttgtatctgtgcgaagagtccctc
aacgccatgcaaggtgctttgggcgcagtgtgcgaggcagtggacactgtctttggtcct
ggtcctcgcaaagcgtttgtcggcgtaagaccccctggccaccattgttctgcttctcat
ccttctggcttctgttgggtgaacaatgttcatgtgggcatcatgcatgctgcacttgaa
catggtctcactcatgcagccataatcgactttgatctccatcacggcgacggctctcag
gccattacttggcagcacaatgcccgcgctaatgctgcgaacaagagccacgcctcttgg
aaaagaacgtcaatagggtacttcagcttgcatgacattaactcttatccttgcgagatg
ggtgatgaagacaaggtcaagaacgcgagtttatgtatcgatagtgcgcatggccagtgt
atctggaatgtccacctacaatcctggaaaacggaacaagagttctggaccctgtacgaa
agtacatatgctgttttgttggaaaagacacgaaagtacttgaaaaatgaggcagccaag
ctgcgtgcctcaaaccaagtccccaaagcggcagtcttcttctctgcgggtttcgatgcc
agtgagtgggagagcgcgggaatgcaacgccaccatgtgaatgtgccgacggagttttat
gccaggctttcgcaagatgttgtgaaactggcgacagaggagggactggctgtagatggc
cgtgtgattagcgtcctcgaaggtggatatagcaatcgcgccttgtgttcagggatactg
agccatctgagtggcctagttggtgttagtcacgatcaaagtccaatcgagacggagcag
gaatctaccgggctcgcgtacgagatgggccaaaggattggagctatcaatttgaacgcg
gatccgacaatgaaacctccggcgtcaatgtacgatgcagcatggtgggcaacgaatgaa
ctagacctcctcgaagaacccgaagagcctctagcagtactgagaaaaccacgcaactct
actcctccgacctactcatcgccaacccaggcctctactgctagagttgctgaccccatc
aagatgaagaacagtctctctagcttgtctaccagctattcgaaagtacctcagaggccg
acatcacccccacctcctgaagtgccttggcatatagctgctaaggaactgtgcaagact
ctgataccatcagatcgtcaaacagacagttgtacggcggaggatctaaatgctgaagca
tcacgggcccggagagatcgccagtctcttttgattgggaaccagccgcccacaccatcc
ggatctgatagatcatcatcgaggatgtcgttacgcgaacgtaaatcgagaccaatcggt
cctattgacgaggaaatgagcgaaatgctaccgaagacaagaagaaagcccgcaagcaca
ccgatatcatccccggcgaaggctgggagaagaacgcctcagccagctggagcgcagtcc
gccagaagatctagccgccgcctgagcgtggcgtctacgaatctgtcccctcccagggaa
gagccacctccggtccctcctatcccagccacagcgcctggccctaaccgaacaaccagt
cggcccaactctagggtgggtaggacacagagcagtaacaaggttcccgtgaagaagagc
caggcagtgccaccccgaatagaccctgcaccgaaaggagggcgagatgtgacaagggcg
agcactcccgctagaggagcgaaacagtctacagttggggctgacacgccgaccccggct
acgggactaccgctcaatgccgtcggtaacgatgccaagagcgatgttgacagtttgacc
aacggtgtcaagaagataagaatcaacttgatcacaaagacacaaaaggatgggaagcag
gccaagtcagaacaaagcgcggaacccggccgccaacttgggcaggattcaagtattgtg
aagtcggagaaaccacctacccctgaaggcatgtcctctataccaaatgctccggagcag
cttccaactcaacttgcgccagcttctggtgttcctgaagcaccaccaacgccgtcacta
agtggaggaatttcaactccggttgaggaaatctacacatctaatgcatcgtcgcccacg
ccgactccgtccattcccacgggaagctctcccgatgtaccgcatgttactattcaacca
gccagcgacgccagcgatgtctttatcccctatcagccggaaggacctgaacctgtcatc
atggggcagcacgagcatctgaggtggcttccgcctaacgttcagacgccttcttctgta
gcgccggttaacacacctctgcctagcgcgacgcaaacgaaaagtaccctattccactac
acctcagggattccattcgccccaaggccggatacagagtcacaaggacgaccaggatct
ctgggcacagcacgtacaggacatgaacagtga

DBGET integrated database retrieval system