KEGG   Metarhizium acridum: MAC_00308Help
Entry
MAC_00308         CDS       T03104                                 

Definition
(RefSeq) DNA ligase I, ATP-dependent family protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
maw  Metarhizium acridum
Pathway
maw03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:maw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    MAC_00308
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:maw03400]
    MAC_00308
Enzymes [BR:maw01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MAC_00308
DNA repair and recombination proteins [BR:maw03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     MAC_00308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N RNA_ligase BRCT_2 DNA_ligase_A_C BRCT DNA_ligase_IV LIG3_BRCT mRNA_cap_enzyme Bac_globin
Motif
Other DBs
NCBI-GeneID: 19244619
NCBI-ProteinID: XP_007806648
UniProt: E9DRD9
LinkDB All DBs
Position
Unknown
AA seq 987 aa AA seqDB search
MSGFNRAKSPDADAEREEEMQYGAVGLTKEELEEKYPNRPHNHSKTLRFSELFLQLFNPL
NENKKQPAAGPARKKGPHGATSLSPQEQRRHIIERFINRWRKEVGNDFYPALRLILPDKD
RDRGVYGLKENAIGKLLVKLMKIDKNSEDGYNLLHWKLPGQTMAARLAGDFAGRCYEVIS
KRPMRIEVGDMTIAEVNEQLDKLAASAGEAENLRVFETFYNRMNAEEMLWLIRIILKQMK
VGATEKTFLYLWHPDGETLFSVSSSLRRVCWELYDPDVRLEQEEAGISLMQCFQPQLAQF
QMPASFQKMTELLRPTEDDPEFWIEEKLDGERMQMHMVADAAHPGGKRFCFWSRKAKDYT
YLYGDGVLDENSSLTRHLKDAFAPGVRNLILDGEMITWDMAVDKIVPFGTLKTAAIAEQQ
NKSGSDASGHRPVYRVFDILYLNDKPLTQYTLRDRHRALEKAIKPVHRRLEIHTHKSATT
ADAIEPMLREVVANASEGLVLKNPRSMYRLNSRNDDWLKVKPEYMSEFGESLDCLVIGGY
YGSGKRGGTLSSFLCGLRVSQNHIQAGDNPEKCYSFFKVGGGFRGEDYAEIRHRTEGKWV
EWDRRKPPTEYIELGGGESKQFERPDVWIRPRDSVVLSAKAASVGPSDSFAMGYTLRFPR
FRRLRLDRAWDSALSVDEFEELKRQVDREAKEKAMTVEDRRRRNPKRAKRSVVIVGEDAT
AVEFRGEASHVFDGLEFCVLSESLKPYKKTKAQLEAVIKENGGTISQRAVAGTNMVLIAD
KNVVKVASLIKGGNVNIIRPKWIRDCVAQGGDFLLPYEEGHLFHATEELRAIAAKNTDMY
GDSYARDVSVDELRGILGGMPKVEEAFDGDHFLAELEERGKGITELRGFMMRRCVVHFRA
VDGVNGSMGKLVHYVMYTGGKVVDSLREGVTHVVVMGDDPMEVGETADTVRRQVSSWAKV
PRVLGDGWVLDCWKERTLLDEEKYMIS
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcttcaacagggccaagtcgccagatgcggatgctgagcgtgaggaggaaatg
cagtatggcgcagtcggcttgacgaaagaagagctcgaggaaaagtacccaaacagaccg
cataatcattccaaaaccctacgcttttccgagctgttcttgcagctcttcaacccgctc
aatgagaacaagaagcagcccgcggctggcccggctcgcaagaagggccctcacggtgca
acttcgctctcgccgcaggagcagagacgccacatcatcgagagattcatcaacaggtgg
cgcaaagaagtcggcaacgacttctatcccgctctgcggctgattctgcccgacaaggac
cgcgaccgtggtgtctacgggctcaaggagaacgccatcggcaagctactggtaaagctc
atgaagattgacaaaaactctgaagatggctacaatctcttgcactggaagctgcccggc
cagacaatggcggctcgactggctggcgactttgccggccgatgctacgaggtcatctcc
aagagaccgatgcggatcgaggtgggcgacatgaccattgccgaggttaatgagcagctg
gacaagttggctgcatcggctggagaagcggaaaacctgagggtgtttgagacgttttac
aatcgcatgaacgccgaggagatgctgtggctcatccgcatcatcctcaagcaaatgaag
gtcggtgccacggagaagacgttcctctacctgtggcaccccgacggcgagacgttattc
agcgtgtcgtcgagcttgagacgcgtgtgctgggagctgtacgacccggacgtcaggttg
gagcaagaagaagccggcatatcgctgatgcagtgttttcagccccaactggcccagttc
cagatgcctgcttcttttcaaaagatgacggagctgttgcggccgacagaggatgacccg
gaattttggattgaggagaagctggatggggagcgaatgcagatgcacatggtggctgat
gccgcccaccccggagggaagcgtttttgcttctggtcgcgaaaggcaaaagattacacg
tatctatacggcgacggcgtactggacgaaaattccagcctgacgcgccacctgaaagac
gcctttgcccccggtgttcgaaatctcatactggacggggagatgatcacatgggacatg
gcggtcgacaaaattgtcccctttggcaccttgaaaaccgccgccattgcagagcaacag
aacaagtccggctccgacgcatccggccaccggcccgtgtatcgcgtctttgacatatta
tatctcaacgacaaacctctcacgcagtacacccttcgcgaccggcaccgcgccctcgaa
aaggcaatcaagcctgttcaccggcgcctcgaaatccacacgcacaaaagcgccacgacg
gccgacgccatcgagcccatgctccgagaagtcgtggccaacgcctcagaaggtcttgtc
ctgaagaacccacgctccatgtacagactcaacagccgcaacgacgactggctcaaggtg
aagccagagtacatgtctgaatttggcgaatcgctggactgcctcgtgataggcgggtac
tacggctccggcaaacgaggcggcacgctgtccagttttctgtgcgggctccgcgtgtcc
cagaaccacatccaggccggcgacaaccccgaaaaatgctacagcttcttcaaggtaggc
ggcgggttccgcggcgaggactacgccgagatacggcaccgcaccgaaggaaaatgggtc
gagtgggacagacggaagcccccgaccgagtacatcgagctcggcggcggagagagcaag
cagtttgagcggccggacgtgtggatccggcccagggactcggttgtgctctcggcaaag
gcagccagcgtcggcccgtcggacagctttgccatggggtacacgctgcgattcccccgg
ttccgccggctacgcctcgaccgcgcgtgggactcggcgctgtcggtggacgagttcgaa
gagctcaagcggcaggtggaccgggaggccaaggagaaggccatgacggtggaggacagg
agacgcagaaaccccaaacgcgccaagagaagcgtcgtgattgtgggcgaggacgcgacg
gccgttgagttccggggcgaggcgtcgcacgtctttgacggtctcgagttttgcgtgctc
tccgagtcgctcaagccgtacaagaagacaaaagcgcagctggaggctgttatcaaggaa
aacggcggcaccatctcgcagcgcgccgtcgcgggtacaaacatggttctcattgcggac
aagaacgtcgtcaaggtggcgagcttgatcaagggcggcaatgtcaatattatccgcccc
aagtggatcagggactgcgtcgcgcagggtggcgattttctgctgccctacgaggagggc
cacctgtttcatgcgacggaggagttgcgcgctattgcggccaagaatacggacatgtac
ggggatagctatgcgcgcgacgtctcggtggatgagctgagggggatattgggcggcatg
cccaaggtggaagaggcctttgacggggatcattttctggccgagttggaagagaggggc
aagggcatcacggaactgagggggttcatgatgaggcggtgcgtggtgcattttcgagcc
gtggacggcgtgaacgggtcgatggggaagctggtccattatgtcatgtatacgggcggc
aaggtggtggacagcctgcgggagggcgtcacgcacgtggtggtcatgggagacgacccc
atggaagtcggggagacggcggacacggtgaggagacaagtgagctcctgggccaaggtg
ccgcgtgttttgggagatgggtgggttctagattgctggaaggagaggacattgctagac
gaggagaagtacatgatttcatag

DBGET integrated database retrieval system