KEGG   Metarhizium acridum: MAC_01061Help
Entry
MAC_01061         CDS       T03104                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
maw  Metarhizium acridum
Pathway
maw00020  Citrate cycle (TCA cycle)
maw00190  Oxidative phosphorylation
maw01100  Metabolic pathways
maw01110  Biosynthesis of secondary metabolites
maw01130  Biosynthesis of antibiotics
maw01200  Carbon metabolism
Module
maw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
maw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
maw_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAC_01061
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MAC_01061
Enzymes [BR:maw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MAC_01061
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 19245372
NCBI-ProteinID: XP_007807401
UniProt: E9DTW3
LinkDB All DBs
Position
Unknown
AA seq 635 aa AA seqDB search
MQFSRLARSQARAFSTTRPAARVIANHPLRAKEASPHVSTKYNVIDHEYDALVVGAGGAG
LRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSDWL
GDQDAIHYMTREAPASIIELEHYGCPFSRTEEGKIYQRAFGGQSQKYGKGGQAYRCCAAA
DRTGHALLHTLYGQSLAHNTNYFIEYFALDLIMQDGECRGVLAYNQEDGTLHRFLANNTV
LATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIYGAGCLITEGARG
EGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIRDGRGVGAEKDHIYLQLSHLPA
EILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRYTGEVLTVDEQGNDKVV
PGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDNFKPGEKLKPLAADAGAEH
IEVLDQVRTSDGPKSTAEIRLAMQKAMQTDVSVFRTQESLDEGVRKMNAIDPMFKEVGIK
DRSMIWNSDLVETLELRNLLTCATQTATSAAARKESRGAHAREDYPDRDDKNWMKHTLSF
QKTPHGKVDLKYRGVISTTLDENECKPVPPFKRVY
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgcagttttcgcgattggcgagaagccaggccagggccttttctactacccgacctgct
gctcgagttattgccaaccatcccctgagagctaaggaggcttctcctcatgtcagcaca
aagtacaacgttattgatcacgagtacgatgccctcgtcgtcggcgccggtggtgctggc
ctccgtgctgccttcggtctcgctgaggctggcttcaacactgcctgtatctctaagctg
tttcctactcgaagtcacactgtcgccgctcagggtggcatcaacgctgctctcggcaac
atgcacgaggatgactggagatggcacatgtacgataccgtcaagggctctgactggctg
ggcgatcaggatgctattcattacatgacccgtgaagctcccgcctccattatcgaactt
gagcactatggttgccccttctcccgaaccgaggagggaaaaatctaccagcgagctttc
ggtggacagtcccagaagtacggcaagggcggccaggcctaccgatgctgcgccgcagct
gaccgaaccggccacgctcttctgcatactctctacggccagtctctcgcccacaacacc
aactacttcatcgagtatttcgctctggatctgattatgcaggatggcgaatgccgtggt
gtcctcgcctacaaccaggaggatggtactttgcaccgattccttgccaacaacactgtc
ctggccaccggtggttatggccgtgcgtactttagctgcacgtctgcccatacttgcact
ggtgacggcatggccatggttgcccgtgctggtctccccaaccaggatctcgagttcgtt
caattccatcctaccggcatctacggtgctggctgcttgatcaccgagggtgctcgcggt
gaaggtggttacctgctcaactctgagggtgaacgttttatggagcgttacgcgcctact
gctaaggatttggcctctcgtgatgtcgtctctcgatccatgaccatggaaattcgtgac
ggccgtggtgtcggtgctgagaaggatcacatctacctccagctcagccacttgcccgct
gagattcttgctgagcgtctgcccggtatctccgagactgctggtatctttgctggcgtc
gatgtccgaaagcaacccattcctgtcttacctactgtccactacaacatgggtggcatc
ccgacccgctacactggcgaggtgcttaccgtcgatgagcagggcaatgacaaggttgtt
cccggtctgttcgcctgtggtgaggctgcttgcgtgtctgtccacggtgctaaccgtctt
ggcgccaactctctgctggatctcgtcgtcttcggccgtgccgtttcgcacactatccgt
gacaactttaagcctggtgaaaagctcaagcctcttgctgctgatgctggtgctgagcat
attgaggttctggaccaggtccgaacctctgacggccccaagagcactgctgagatccgt
ctggccatgcagaaggccatgcagactgatgtctccgtgttccgcactcaggagagtttg
gacgagggtgtacgcaagatgaacgcgattgaccccatgttcaaggaagttggcatcaaa
gaccgcagcatgatctggaactctgacctcgtcgagactctagaactgcgaaacctcttg
acttgcgctacccaaactgctacttccgccgctgcccgaaaggagtcccgtggtgcccac
gccagggaggattaccccgaccgagacgacaagaactggatgaagcacactctatccttc
cagaagacgcctcacggcaaggttgacctgaagtaccgtggcgttatttcaaccactctg
gatgagaacgagtgcaagcctgtacctcccttcaagcgtgtatactaa

DBGET integrated database retrieval system