KEGG   Metarhizium acridum: MAC_01763Help
Entry
MAC_01763         CDS       T03104                                 

Definition
(RefSeq) manganese superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
maw  Metarhizium acridum
Pathway
maw04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:maw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MAC_01763
Enzymes [BR:maw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MAC_01763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 19246074
NCBI-ProteinID: XP_007808103
UniProt: E9DVW5
LinkDB All DBs
Position
Unknown
AA seq 228 aa AA seqDB search
MSSALLRTTPVVRAGLRAAKPMAMASTSFVRGKATLPDLPYDYAALEPYISGQIMELHHS
KHHQTYVNSFNAATEALAEALSKNDTKAAAAQAPLLNFHGGGHVNHSLFWENLAPSGKGG
GGEPEGKLLTAINEDFGSFDNLKKQTNAALGGIQGSGWAWLVKDKTSGTLSLVTRANQDP
VTGNLEPLLGIDAWEHAYYLQYQNRKAEYFSAIWEVINWGTVSKRFEK
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcagcgcttcttcgcaccacgcccgttgtgagggccggccttcgcgctgctaag
cccatggccatggctagcacaagcttcgttcgtggcaaggccactctgcctgatcttccc
tacgactatgccgctctcgagccctacatctccggccagatcatggagctccatcattcc
aagcaccaccaaacctatgtgaacagcttcaatgccgccaccgaagcgctcgccgaggcc
ctttccaagaacgacaccaaagcggccgctgctcaagctcctcttctgaacttccacggc
ggtggccacgttaaccactcccttttctgggagaacctggcccccagtggaaagggcggc
ggtggtgagcccgagggcaaacttttgaccgccatcaatgaggatttcgggtcgttcgac
aacttgaagaagcagaccaatgcggctcttggtggcatccaaggctctggctgggcctgg
ctcgtcaaagacaagacctcgggcacactgtctcttgtcactcgtgccaaccaggatccc
gtcactggcaaccttgagcctctcctgggtattgacgcctgggaacatgcttactacttg
cagtaccagaatcgcaaggctgagtacttcagtgccatctgggaggtcatcaactggggc
actgtttccaagcgttttgagaaatga

DBGET integrated database retrieval system