KEGG   Metarhizium acridum: MAC_02414Help
Entry
MAC_02414         CDS       T03104                                 

Definition
(RefSeq) Histone-lysine N-methyltransferase, H3 lysine-4 specific
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
maw  Metarhizium acridum
Pathway
maw00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    MAC_02414
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:maw03036]
    MAC_02414
Enzymes [BR:maw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MAC_02414
Chromosome and associated proteins [BR:maw03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     MAC_02414
   HMT complexes
    COMPASS/SET1 complex
     MAC_02414
    COMPASS/SET1 complex (yeast)
     MAC_02414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET_assoc SET
Motif
Other DBs
NCBI-GeneID: 19246725
NCBI-ProteinID: XP_007808754
UniProt: E9DXR6
LinkDB All DBs
Position
Unknown
AA seq 1231 aa AA seqDB search
MTRPPPGVSFAQFFPNAPKVRAEAQGRADRERSRHNSIQGSESCSDPAAGAVNSNATGFA
RLSQSNIPSDAPHSQNDDHDTPLGDIPSTVGSASSHTSSAPSIFSASQRQTTTTASSHIS
ARTTPLTARDSSSYSPVPSSSKPDMPPLEAADHGSGQTHTAGLAKDDNGLSSFGTQHTDR
PSARDPFPSVKGLICTYDPILDRARNKGAGKSSKPTYTEFGLNDDAPPSDPRLQKAGGRL
GYINTDYYLPKARLRPAPENLKPYPYDVKTSIGPGPPTQIVVTRYNPLVPFNKVTAVFAT
FGEIAESSNKMHPDTGSYLGFATIRYRDSKRSGRPAVSAIDAARRAVRARGIKIDADMVK
VDYDPEGRKSRRMLEEHLKREREKYNKEKLARDQAASKAPPTGPKSSAPAAPFVRPPPTA
PKGPTGPWPTPAIVPPQPSPTPPARPQVPIEPQNISHQLANDPYIFISSDDVPILPSIVP
HMKKRLKNYGFEEIRLDRTGFYVVFRNSFTGKSEAERCYRAVNHTEFFNYDMAMQLCLPR
PTRGADSERRRSPSPPPPRDRERDQELLARRRHEEMKRRRREEEADLEEEKKQRAKNFDP
VFEAVEAVRREMTEHLIRHIRTQVAAPCLSDFLNPSNHVAKRRKFNLDQIDDDEDNDSNS
PRIGTPNSGADPIERRTGRLEPKALPRIRKVKAKGSHRNMFVDPFSRKRQSAGRSAFRSL
HHRFKSLDSDFESDDDTDTRALAARDTEEPESRPRSRMSTDDEFGSWGRGGDDDSMTESS
LAILDRSSLKKRKLEASIEKAFKRQKKSDEELFGVKISRIDTDIDGRGASTDIGADVDLL
GDLDSGMSRPETPVPQTLKGVKKKAVKPKKKTKKQLLEEQEALKQQQEAELGDEGDEELP
LPAKVEEQSIPQADAPIDKYDERLFSTTPLTAALILPDDFKPDIAALQNIALGIKDKPDL
AKLQKKFSVADVGNAELWLWKRNRVRELNSTSSSSDHPVSIGGYYVPNPTGCARTEGVKK
ILNSEKSKYLPHHIKVQKAREERQARSKRNGKDSVHAASEAAKIAAEKIAKGNSRANRAT
NRRYVADLNDQKKTLGQDSDVFKFNQLKKRKKPVKFARSAIHNWGLYAMENINKDDMIIE
YVGEEVRQQIAEIRENRYLKSGIGSSYLFRIDDDTVIDATKKGGIARFINHSCMPNCTAK
IIKVEGSKRIVIYALRDIAMSKQLSLESKVA
NT seq 3696 nt NT seq  +upstreamnt  +downstreamnt
atgactcggccgcctccaggcgtgagtttcgcgcagttctttccaaacgctccaaaagtg
agagcagaggcccaaggccgggcagatcgcgagcgttcacggcacaatagcatccaaggt
agcgaatcatgctcagatcccgctgccggcgcggtgaattcgaatgcaaccggttttgct
cggctgtcacaatctaatatcccttcggatgccccccactcacaaaacgacgatcacgac
actcctctgggagatatacccagtactgttggatcagccagctcgcacacgagctctgcg
ccctctatttttagcgcctcacaaaggcaaaccacaacgacggcctcatctcacatatct
gcaagaacgacgcctctcaccgcgcgggactcatcgtcctactcaccggtcccctcatct
tcaaagccagatatgcctccactggaggcagccgaccatggctcgggacaaactcatacc
gcaggccttgctaaagacgataatggtctgagctcattcggcacccaacatactgatcgc
ccgtcggctcgagatccatttccatctgtcaaaggcctgatatgtacatatgatccgatc
ctcgatcgagcacggaataaaggagctggcaaaagttccaaaccgacatatacagaattc
ggattgaacgatgacgctcccccttccgacccgcgtttgcaaaaggctgggggccggctt
ggctacatcaataccgactattatctaccaaaagctcgattgcgccctgcgccagagaac
ctcaaaccctatccgtatgatgtaaagacatccatcggacctggcccgccgacgcagatc
gtcgtgacgcggtacaatcccctggttcccttcaataaagtgacggctgtctttgcaaca
tttggagaaattgcggaaagcagcaacaaaatgcatcctgatacaggcagctaccttggt
tttgcgaccattcgctatcgtgactctaagcgctcaggacgaccagccgtctccgcaatt
gatgccgcccgccgtgccgtgcgagcccgtggtataaaaatcgatgcggacatggtcaag
gttgactatgatccagagggacgtaagagccgacgaatgcttgaagaacatctcaaacga
gagagagagaagtataacaaggagaagttggctagggatcaggccgcttctaaagcacct
ccaacaggtccaaaatcttcagcaccagcggcgcctttcgtgcgacctcccccgacagca
cccaaaggaccaactggaccgtggccaacgcctgctatagtaccaccacaacctagtcca
acgccgcctgccaggccacaggtacccattgaaccgcagaatatctcacatcaattggcg
aatgacccttatatttttatctcttctgatgatgtgccgatattgcctagtatcgtaccg
cacatgaaaaaacgattaaagaattacgggtttgaagaaattcgtctcgaccgtaccggc
ttctacgttgtctttcgaaactcgtttacggggaagtcagaggcagaacgatgttaccga
gccgtcaatcataccgaattcttcaactatgatatggcaatgcagctttgcttgccgaga
ccaactcgtggtgcggactctgaacgcagacgcagtccctctcctccgcccccaagagat
agggaacgggaccaagagttattagcacggcgacgacatgaggaaatgaaacgacgtcga
cgagaagaggaagcagacctcgaagaagaaaagaagcagagagctaagaactttgatcct
gtcttcgaggccgtcgaggcggttcgacgagaaatgacggagcacctgatacggcatatt
cggacacaggtggccgcaccatgcctctctgacttcctcaatccatccaaccatgtcgcc
aagagacgaaaattcaacctggaccagattgatgacgatgaagacaacgatagcaatagc
ccgaggattgggacaccgaattcaggagcggatccaattgaacggcgaactggacgtctt
gaaccaaaagcactgccccggatacgaaaagtcaaggctaagggcagccaccgaaatatg
tttgttgatcccttttcacggaagcgccagtctgccgggagaagtgctttccgttccttg
caccatcgtttcaagagtctggacagcgactttgagtccgatgatgatactgacactaga
gcgctggctgctcgtgacaccgaagagcctgaatcgcgacctcgaagtcgcatgagcacg
gatgacgaatttggctcttggggtcgcggtggagacgacgacagtatgacagaatctagc
ctggctatattagatcggtcatcgttgaagaaaaggaagttggaagcttctatcgagaag
gcttttaagcgacaaaagaaatccgatgaagaactatttggtgtcaaaattagccgcatc
gacacagatattgatggacgcggggcatctacagacattggtgctgatgttgatctgttg
ggtgaccttgacagtggtatgtccagaccggagacacccgtacctcaaactttgaagggc
gtaaagaagaaggcagtaaagccgaagaaaaaaaccaagaagcaactcttggaggagcag
gaagctctgaagcagcagcaagaggcagagctcggcgatgaaggcgacgaggagcttcct
ttgcctgccaaggtggaggagcagagcattcctcaagctgatgcacctattgacaaatac
gatgagcgacttttttctaccacaccactcaccgccgctctcatattgcccgacgatttt
aaacccgatattgctgctttgcaaaacatagctcttggcattaaagacaagcctgattta
gctaagctgcaaaagaagtttagcgttgccgatgttggaaacgcagagctctggttatgg
aagcgcaaccgtgtcagagagctgaactcgacgagcagctcttccgatcacccagtatct
atcggaggatactacgttccaaatcccacaggctgtgcgcgtactgaaggagtcaagaaa
attcttaactctgagaagtcaaaatacctgccacatcatatcaaagtgcagaaggctaga
gaagaacgccaggcgcggtccaagaggaatggcaaagacagtgtccatgctgcgtctgaa
gcagccaagattgcagcagagaagatcgccaagggcaactcacgtgccaatcgggctaca
aaccgtcgttatgttgctgatctgaatgaccaaaagaagacgctcgggcaggattctgat
gtcttcaagttcaaccagcttaagaagcgaaagaagcccgtcaagtttgctcgatctgct
atccacaattggggcctctatgccatggaaaatatcaacaaggacgacatgattatcgag
tacgttggtgaggaagtccgtcaacaaatcgcggaaattcgagagaaccgttatctcaag
agcggcattgggagtagctaccttttccgcattgatgacgacactgtcattgatgcaacc
aaaaaggggggcattgcacggttcatcaatcacagctgtatgccgaattgtacagccaag
attatcaaagtcgaaggcagcaagagaatcgtcatatatgccctccgtgacattgcaatg
agtaagcaactttctttggagagcaaggtggcctga

DBGET integrated database retrieval system