KEGG   Metarhizium acridum: MAC_02975Help
Entry
MAC_02975         CDS       T03104                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
maw  Metarhizium acridum
Pathway
maw00010  Glycolysis / Gluconeogenesis
maw00051  Fructose and mannose metabolism
maw00052  Galactose metabolism
maw00500  Starch and sucrose metabolism
maw00520  Amino sugar and nucleotide sugar metabolism
maw01100  Metabolic pathways
maw01110  Biosynthesis of secondary metabolites
maw01130  Biosynthesis of antibiotics
maw01200  Carbon metabolism
Module
maw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
maw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAC_02975
   00051 Fructose and mannose metabolism
    MAC_02975
   00052 Galactose metabolism
    MAC_02975
   00500 Starch and sucrose metabolism
    MAC_02975
   00520 Amino sugar and nucleotide sugar metabolism
    MAC_02975
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MAC_02975
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:maw04131]
    MAC_02975
Enzymes [BR:maw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     MAC_02975
Membrane trafficking [BR:maw04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    MAC_02975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 19247286
NCBI-ProteinID: XP_007809315
UniProt: E9DZC7
LinkDB All DBs
Position
Unknown
AA seq 486 aa AA seqDB search
MANNLAAGSKADIPQDLLNEVKRLEDLFTVDTQTLKKITDHFISELAKGLSVEGGSIPMN
PTWVMSFPDGYETGTFLALDMGGTNLRVCQITLTEQKSEFDILQSKYRMPEELKTGNSDE
LWEYIADCLQQFVETHHGGCAGIGTLPLGFTFSYPATQNYIDEGILQRWTKGFDIAGVEG
QNIVPMLNAALEKKGVPIRLTALINDTTGTLIASAYTDPKMKIGCIFGTGCNAAYMEDVG
SIPKLAHMKLPPETPMAINCEWGAFDNEHKVLPRTEFDKIIDRDSPRPGQQAFEKMIAGL
YLGEIFRLVMVDLHDNRDVHVFAGQDISLLRKAYSLDSSFLSAVEEDPFENLQETFDLFS
SKLNITCSRPELELIRRLAELIGTRAARLSATGVAAICKKKDFKTCHVGADGSVFNKYPQ
FKERGAQALREILDWPEKKNPKEEDPIEILAAEDGSGVGAALIAALTLKRVKAGNVAGVL
HPEHFK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaatctcgcggcaggctcgaaggcggatattccccaggatctgctcaacgaa
gtcaagaggctcgaggatctcttcacagttgacacacagacgctcaagaaaattacagac
catttcatttccgagttggccaagggtcttagtgtcgagggtggcagcattccaatgaac
ccaacctgggtcatgtcattccccgatggctatgaaaccggcaccttccttgctcttgac
atgggcggcaccaacctccgtgtgtgccagattaccctgaccgaacagaaatccgaattt
gatatccttcagtccaagtatcgcatgccagaggagctcaaaaccggcaactcggatgag
ctttgggaatatattgcggactgtctgcagcagtttgtagagactcaccacggcggttgc
gctggcattggcacccttcctcttggtttcaccttctcgtatccagcaacacagaactac
attgacgagggtattcttcagagatggaccaaggggttcgacattgctggtgtcgaaggg
cagaatattgttccaatgttgaacgctgctctcgagaagaagggagtgcccatcaggctt
actgctctgatcaacgatacgacgggaactctgatagcttccgcatacactgacccaaag
atgaagattggctgtatctttggcaccggctgcaatgctgcctatatggaggatgttggc
tctattcccaaactagcacacatgaagctgccaccagagactcccatggctatcaactgc
gagtggggtgctttcgataacgagcacaaggtgctgcctaggactgagtttgacaagatt
attgaccgtgattcaccccggccaggtcagcaggcctttgagaaaatgattgctggtcta
tatcttggcgaaattttccgacttgtcatggttgatttgcacgacaatcgcgacgtacat
gtctttgccggccaggatatttccctgctgcgcaaagcttattctctggattcctctttc
ctttctgctgttgaagaggatccttttgagaatttgcaggagacgtttgacctattcagc
tccaaactcaacattacttgctccagaccagaattggagctcattcgacggctcgccgag
cttatcggcactcgtgctgctcgcctctctgccactggtgttgctgccatctgcaagaag
aaggactttaagacctgccatgtcggtgctgatggatccgttttcaacaagtacccacag
ttcaaggaacgtggtgcccaggctctccgtgagattcttgactggcctgaaaagaagaat
cccaaggaagaggatcctattgagattcttgctgccgaggacggtagcggtgtaggcgcc
gctttgattgcggcgttgactctgaagagagtcaaggctggcaatgttgctggagtgctg
catccagagcacttcaaataa

DBGET integrated database retrieval system