KEGG   Metarhizium acridum: MAC_03404Help
Entry
MAC_03404         CDS       T03104                                 

Definition
(RefSeq) L-galactonate dehydratase
  KO
K18102  L-galactonate dehydratase [EC:4.2.1.146]
Organism
maw  Metarhizium acridum
Pathway
maw00040  Pentose and glucuronate interconversions
maw01100  Metabolic pathways
Module
maw_M00630  D-Galacturonate degradation (fungi), D-galacturonate => glycerol
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MAC_03404
Enzymes [BR:maw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.146  L-galactonate dehydratase
     MAC_03404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-GeneID: 19247715
NCBI-ProteinID: XP_007809744
UniProt: E9E0K6
LinkDB All DBs
Position
Unknown
AA seq 451 aa AA seqDB search
MTQEITITGFETRDVRFPTSLDKTGSDAMNAAGDYSSAYCILQTDSQYSGHGMTFTIGRG
NDIVCAAIVHVAERLKGKTLSSLVANWGKTWRYLVSDSQLRWIGPEKGVIHLALGAVVNA
VWDLWGKVLGKPVWRIVADMTPEQYVECIDFRYITDAITPEEAVAMLEEVQGGKAKRIEE
ALNSKAVPAYTTSAGWLGYGEDKMKTLLRETLAQGYKHFKLKVGGSVEEDRRRLTIARDV
LGYDKGNILMVDANQIWSVPDAIKHMKQLADFKPWFIEEPTSPDDILGHKAVREALKPYG
IGVATGEMVQNRVVFKQMLMNGAIDVCQIDACRLGGVNEVMAVLLMAKKYGVPIVPHSGG
VGLPEYTQHLSTIDYVAVSGELSVLEYVDHLHEHFLHPSVIKGGYYQTPMEPGYSVEMKT
DSMDKFTYPGEKGISWWTSEEAKPILEGEKI
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagaaatcacaatcaccggatttgaaacccgcgatgtgcggtttcccacgtcg
ctggataagacgggctccgatgctatgaatgccgctggtgattactcttctgcgtactgc
atcttgcagacagactcacaatactctggccacggcatgaccttcaccattggacgcgga
aacgacattgtttgcgctgccatagtccacgttgccgagcgtctcaagggcaagacattg
tcgtctctggtggccaactggggaaagacttggcgctatctagtatcagacagccaactg
cgttggattggacccgagaagggtgttattcacctcgccctcggcgctgtcgttaatgcg
gtctgggacctttggggcaaagtcctgggcaagcctgtctggagaattgttgccgacatg
acgcccgagcaatacgtcgagtgtatcgacttccgctacattaccgacgccatcacccca
gaagaagccgttgccatgctcgaggaagtgcaaggaggaaaggcgaagcgcatcgaggaa
gcgctcaacagcaaggccgtgccagcgtacaccaccagcgcaggatggctaggctacggc
gaagacaagatgaagacgctcctcagggagacacttgcacaaggttacaagcacttcaag
ctgaaagttggcggtagcgtggaggaggacaggcgccggttaaccattgcccgggacgtt
ctcggctacgacaagggcaatatcctcatggtcgatgcgaaccagatctggtctgtcccc
gatgccatcaagcacatgaagcagctcgccgactttaagccatggttcatcgaagagccc
acgtcccccgacgacatcctgggccacaaggctgttcgcgaggctctcaaaccatacggc
attggcgtcgccactggcgaaatggtccaaaaccgagtcgtcttcaagcagatgctcatg
aatggggccattgacgtctgtcaaatcgatgcctgccgccttggtggtgttaacgaggtc
atggctgtgttgctcatggcgaagaagtacggtgtgccgatcgttcctcattccggcgga
gttggtcttccagagtacacgcagcacctgagcacaattgattatgtagctgtgagcggt
gagctttctgtgttggagtatgttgaccatttacacgagcacttcttgcatccgtccgtc
atcaagggcgggtactaccagacacccatggaacctggatatagtgtagagatgaagacg
gatagtatggataagttcacgtatcccggggagaaggggattagttggtggacgagcgaa
gaagcaaaaccgattttggagggtgagaagatttga

DBGET integrated database retrieval system