KEGG   Metarhizium acridum: MAC_03466Help
Entry
MAC_03466         CDS       T03104                                 

Definition
(RefSeq) alanine aminotransferase, putative
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
maw  Metarhizium acridum
Pathway
maw00220  Arginine biosynthesis
maw00250  Alanine, aspartate and glutamate metabolism
maw01100  Metabolic pathways
maw01200  Carbon metabolism
maw01210  2-Oxocarboxylic acid metabolism
maw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAC_03466
   00220 Arginine biosynthesis
    MAC_03466
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:maw01007]
    MAC_03466
Enzymes [BR:maw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MAC_03466
Amino acid related enzymes [BR:maw01007]
 Aminotransferase (transaminase)
  Class I
   MAC_03466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 19247777
NCBI-ProteinID: XP_007809806
UniProt: E9E0R8
LinkDB All DBs
Position
Unknown
AA seq 479 aa AA seqDB search
MRLARDTINQHVVRAQYAVRGELAVKSEEYRARLKDGDTNLPFDQVISANIGNPQQLDQK
PITFFRQVLSLLENPELLKKEDVLINGLGYKTDVIERAKWLLKQVGSVGAYSASAGAPAI
KESIAAFLERRDGFPADPSKIYLSTGASSGVNTLLHVICADKKSGIMIPIPQYPLYSATL
SLLDAQAVPYYLDESKAWGTSFETIKAAYEKGKADGLDVRCIVIINPGNPTGASLSEEDV
RSVIDFAQQENLVIMADEVYQTNVFIGQFHSFKGVLRKLQKENPGKYDGVELASLHSISK
GMVGECGHRGGYFELVGFDPEVEAQIYKFVSIMLCAPVIGQCLVELMVNPPRPGEPSYEL
YSQEYSGIHEGLRERASALHKAFSQMEGVQCAEPQGAMYLFPTVQLPAKAHEAAAAEKRT
ADEFYCLKLLEATGVCVVPGSGFGQEEGSLHFRTTFLAPGTEWVAGIVKFHKEFMDKYR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagattggcccgcgataccatcaaccagcacgtcgtgcgtgcccagtacgccgttcgt
ggcgagctcgccgtcaagtctgaagagtaccgtgcccgcctcaaggacggtgacaccaac
ctgccctttgatcaggtcatctcggccaacatcggaaacccccagcagctcgaccagaaa
ccgattacctttttcaggcaagttctgagcttgctggagaaccctgaacttctcaagaag
gaggatgttttgatcaatggtcttggctacaagactgatgttattgagcgtgccaaatgg
ttgctaaagcaggtcggctctgttggtgcatacagtgccagtgctggcgcccctgctatc
aaggagagcattgctgctttcctggagcgtcgcgatggctttcctgctgatccttccaag
atctacctctcgactggcgcctcatctggtgtcaacactcttctccacgtcatttgcgcc
gacaagaagtcgggtatcatgattcccattcctcaataccctctttacagcgccactctg
tcccttctggacgcccaagccgttccatactacctcgatgagtccaaggcttgggggacc
agctttgaaaccatcaaggccgcctacgaaaagggcaaggccgacggtctcgatgtccgc
tgcattgtcattatcaaccctggcaatcccactggtgcttccctctccgaggaggacgtt
aggtccgtaatcgactttgctcaacaggagaacctcgtcatcatggccgatgaggtgtac
cagaccaacgtcttcattggccaattccacagcttcaagggcgttctgcgcaagttgcaa
aaggagaaccccggcaaatacgatggtgtcgagcttgcttcacttcacagcatttcgaag
ggcatggttggcgagtgcggccatcggggcggctactttgagcttgttggctttgatccc
gaggttgaggcccaaatctacaagtttgtgtccattatgctctgcgctcccgtcatcggc
cagtgcctcgtcgagctcatggtgaacccacccaggcctggtgagccgtcatacgagctc
tacagccaggagtactctggcatccatgagggactccgcgagcgcgcttccgccctccac
aaagccttcagccagatggaaggtgtccaatgcgctgagccccaaggtgccatgtacctc
ttccccaccgtccagttacctgcaaaggctcacgaagccgccgccgccgaaaagcgcacc
gccgacgaattctactgcctgaaattgctcgaggccacaggtgtctgtgttgttcctggg
tctggcttcggtcaggaggagggctcgctccacttccgaactactttccttgcgcctggt
acagaatgggttgctggtattgtcaagtttcacaaggagtttatggacaagtacaggtaa

DBGET integrated database retrieval system