KEGG   Metarhizium acridum: MAC_04274Help
Entry
MAC_04274         CDS       T03104                                 

Definition
(RefSeq) glutathione-S-transferase theta, GST, putative
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
maw  Metarhizium acridum
Pathway
maw00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MAC_04274
Enzymes [BR:maw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MAC_04274
Transporters [BR:maw02000]
 Other Transporters
  Pores ion channels [TC:1]
   MAC_04274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N GST_C GST_C_3 GST_C_5
Motif
Other DBs
NCBI-GeneID: 19248585
NCBI-ProteinID: XP_007810614
UniProt: E9E326
LinkDB All DBs
Position
Unknown
AA seq 277 aa AA seqDB search
MANADTSLPPEPSGAAAELASRHASQHPLKLYGGWFCPFVQRAWITLCEKRIPHQYIEIN
PYKKEADFLAMNPRGLVPTLAVPAGPEGESHKPLYESLVICEYLDDAYSDESKYGRRLLP
SDPYERARARLWIDHVSTRIVPAFYRFLQHTPEKPYSIEQARAEFHNHIRTLAEQMDPDG
PWFLGEHLSLVDISLAPWAKRLWLLDHYKSGGLGIPQTDGDAIWQRWFKWYHAIVDRQSV
KDTWSADERYIIAYKRYADDTTNSLVGQATRQGQRLP
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgctgatacttcacttccgccggagccatcgggggcggctgccgagttggct
tcccgccatgcctctcaacatccactcaagctatacggcggatggttctgccctttcgtt
cagcgggcttggatcaccttgtgtgagaagcggattccacatcaatacattgaaatcaac
ccgtacaagaaagaagccgactttttggccatgaaccctcgcggcttggtgccaacacta
gctgttcccgctgggccagagggggagagccataaaccactgtatgaaagtctggtcatc
tgtgaatacttggacgacgcgtactcggatgaatccaagtacggccgtcgtttgcttccg
tcggatccctacgagcgtgcccgcgcccggctgtggatcgaccatgttagcacaagaatc
gtcccggccttctatcggtttctacagcacactccagagaagccatacagcattgaacag
gctcgggcagagtttcacaaccatatacgcaccctagcagagcaaatggatcctgatgga
ccgtggtttttgggcgagcacctgagtttagtcgacattagcctggccccttgggcaaaa
cgactgtggctgcttgatcactataaatcgggcggactaggcattccacaaaccgatgga
gatgccatctggcaacgttggttcaagtggtatcatgccattgtcgaccggcagagcgtc
aaggacacatggagcgctgatgagcgatatattatagcttacaaacgctacgcggatgat
accacaaattcgctcgtcgggcaggccacgagacaggggcagaggttgccatga

DBGET integrated database retrieval system