KEGG   Metarhizium acridum: MAC_04649Help
Entry
MAC_04649         CDS       T03104                                 

Definition
(RefSeq) DNA ligase I, putative
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
maw  Metarhizium acridum
Pathway
maw03030  DNA replication
maw03410  Base excision repair
maw03420  Nucleotide excision repair
maw03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:maw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MAC_04649
   03410 Base excision repair
    MAC_04649
   03420 Nucleotide excision repair
    MAC_04649
   03430 Mismatch repair
    MAC_04649
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:maw03032]
    MAC_04649
   03400 DNA repair and recombination proteins [BR:maw03400]
    MAC_04649
Enzymes [BR:maw01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MAC_04649
    6.5.1.6  DNA ligase (ATP or NAD+)
     MAC_04649
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MAC_04649
DNA replication proteins [BR:maw03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    MAC_04649
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     MAC_04649
DNA repair and recombination proteins [BR:maw03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     MAC_04649
   NER (nucleotide excision repair)
    Other NER factors
     MAC_04649
   MMR (mismatch excision repair)
    Other MMR factors
     MAC_04649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 19248960
NCBI-ProteinID: XP_007810989
UniProt: E9E451
LinkDB All DBs
Position
Unknown
AA seq 871 aa AA seqDB search
MSSPSKKRKLDTGGKQHGGPTRGLEFFFAKQRQSSAATSSADAVDVPDLASTELTDEELA
RRIQAEWNKEVTDESRNETENTRSASPASNLAIDELAPAAQPELEPRVTKEAELPASKGA
TLTLQSTGMAEDVITTNIPLDEAPLIFQPSKYLDLLREHWAAEGGNASYALLTRCFVLVS
GTTSRIKIVDTLVNCLRLLVEGDPSSLLPAVWLATNSISPAYISLELGLGGSAISKALKQ
VCGLDNRSLKAIYDKYGDAGDVAFEAKKKQSFTLRKPKPLTIKGVYQDLVKIASSQGQGS
AQAKQRIVDRLLQDARGGEESRFIVRTLCQHLRIGAVKTTMLIALSRAFLLSRPPGAHYS
PLSIPALSKLRKEDLAEIWGKAEETVKACFARRPNYNDLIPVLLEIGISDELLIRCGLAL
HIPLRPMLGSITRDLSEMLTKLQGRDFACEYKYDGQRAQVHCDDGGKVSIFSRHLELMTD
KYPDLVELVPRIRGEGVSSFIMEGEVVAVDRETGELKNFQTLTNRARKDVQIGSIKIDVC
LFAFDLMFLNGQPLLDRPFRERRELLRSLFTEVPHNFTWVKSLDATSSDSETVLDFFKSA
TESKCEGIMVKILDNLVDIPYLGDEEEPAAEETERVPTPKPKSKAKKKGNGATATGEGDK
KTTGSRRKPLLATYEPDKRLDSWLKVKKDYNSSFDTLDLIPIAGWHGQGRKAKWWSPVLL
AVRNEETGMLEAVCKCMSGFTDTFYKAMRQFYDDGEDSGERKNTRSQMPSFIQYSGPMPD
VWFEPQEVWEMAFADVTLSPTYTAAIGLVSDERGLSLRFPRFLKKREDKSLEEASTNEFL
AGLWRKQEAKAAPREAPDGRGDGEPEQMEDE
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtccatccaaaaagaggaagcttgatactggtggaaagcaacatggaggaccg
actagaggtttagagttcttctttgccaagcaaagacagagcagtgcagcaacttcctca
gcagatgccgttgacgtgcctgacttggcatctacggaactaacagatgaagaattggcc
cgtaggattcaagctgaatggaataaagaagtaacagatgagagcagaaatgaaaccgag
aatactcggagcgcttcaccggcctcgaatctggcaatcgatgaactagcgcccgctgcc
caacccgagttagagcctcgtgtgacaaaagaggccgaattgcctgcttctaagggggct
actcttacattgcaatctacaggcatggccgaggatgttattactaccaacatccctctt
gatgaggcccctttaatatttcagccatcgaagtatctcgacttgttgagggaacactgg
gcagccgaaggtggaaacgcctcctacgctttgctcacccgatgtttcgtcctcgtcagc
ggcacaacgagccgcattaaaatagttgatacgctcgtgaattgccttcgactgctagtt
gaaggagacccttcaagtctcctgccagccgtatggctggctacgaactctatatcgcca
gcatatatatccctggaactggggctagggggctctgcaatatccaaagctctaaagcaa
gtgtgcggcttggacaatagatcactgaaggcaatctatgataaatacggtgatgccggc
gatgtagcgtttgaagctaaaaagaagcagagcttcacactgagaaagccgaagccactt
acgatcaaaggcgtttaccaggaccttgttaaaattgctagctctcaaggacagggcagc
gctcaggcaaaacagcgtattgtggatagactattgcaagatgcgaggggtggagaggag
agtcgcttcattgtccggacgctctgccagcatctaagaattggcgccgtgaaaaccacc
atgctcattgctctgtcaagagcctttctgctatctcggcctcctggtgcacactactct
cctttgtctatccccgcactttccaagctgaggaaagaagatctagccgagatttggggg
aaagccgaggaaactgtcaaagcttgcttcgcacgacggcccaactacaacgatttgatc
ccagttcttttggaaattggaatatcagacgagctgttaattagatgcggattagctctg
catattccacttcgacccatgttgggcagcattaccagagacttgtcggaaatgttgacg
aaacttcaaggaagagattttgcctgtgaatataagtacgatggccaaagggcccaggtg
cattgcgacgatggaggaaaagtatcgatcttttcacggcacctagaacttatgacggac
aaatatcctgatcttgtagaattggttcctaggatccgtggagagggtgtcagtagcttc
atcatggagggcgaggtggttgcagtggaccgagaaaccggcgaactcaagaactttcag
accttgacaaaccgggcgagaaaggacgtgcaaatcggcagcatcaagattgatgtctgc
ctgtttgcctttgatttgatgttcctcaacgggcagccgttgctggaccgcccattcagg
gaaagacgggagttgctccgatcactgttcaccgaggtgccgcacaatttcacctgggtg
aaaagccttgatgcgacatctagtgactcagaaacggtgcttgacttcttcaaatcggcc
acggagagcaaatgcgaaggaatcatggtcaaaattcttgacaacctggttgatattcca
tacttgggagacgaagaggagccggccgctgaggaaacagagagggttccaacaccaaag
ccaaagtctaaagcaaaaaagaaaggaaatggcgcaacagcaacgggagagggggacaag
aagacgacgggttctcgacgaaagccccttctcgcgacgtatgaacccgacaagcggctt
gactcgtggctcaaagtgaagaaagactacaattccagctttgatactctggacttgatc
cccattgcaggatggcacggacagggtcgaaaggcaaagtggtggtcgccagttcttctt
gctgttcgcaacgaagagacaggcatgctagaagcagtgtgcaaatgcatgtctggcttt
accgacacattctacaaggccatgaggcagttctacgatgacggcgaagacagtggagag
cgcaagaatacacggtcacagatgccaagtttcatccagtactctggccccatgccggac
gtctggtttgaacctcaggaggtgtgggaaatggcctttgcagatgttaccctaagtcca
acttacacagcggccatcggccttgtcagcgatgaacgaggtttaagtttgaggtttccg
cggttccttaagaaacgggaggacaagagcttggaagaagcgagcacgaatgagttcctg
gccgggctgtggaggaaacaggaggcaaaggcggccccgcgagaggcaccagatgggaga
ggagatggagagccagagcagatggaggatgaatga

DBGET integrated database retrieval system