KEGG   Metarhizium acridum: MAC_05107Help
Entry
MAC_05107         CDS       T03104                                 

Definition
(RefSeq) tuberin
Organism
maw  Metarhizium acridum
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3384 Rap_GAP Tuberin DUF5576
Motif
Other DBs
NCBI-GeneID: 19249418
NCBI-ProteinID: XP_007811447
UniProt: E9E5F9
LinkDB All DBs
Position
Unknown
AA seq 1595 aa AA seqDB search
MSPQPEDDPTSPDSTRPGGLATVLRSLTNSKAIKAPPPPSNPSAALPRAELINAIPTNSH
GLSTNHMDAFEQLKNGSPSERISAANTLKYAITEYPLNPILDIWYAAKDLIDPNNPPSTR
AAGWELLTECAKHASSTDLERKEYFQTLSASANPEDFHLQLAALVDLTSHGRVLDGFDYD
LLPLLTIWLQNAYNAARIARKNSHSGRGAGGSSRGKTAALGEDKNFAQLFLFLLDVIKFS
FNTADEPAVTDLIDTILTICMNTSQEDDLRSCINVLDAIVTFGSIPQSKLKDCVQVLSSI
YCLVPNLQKNSWHTIANLCKSHNGQATVRIMLDILRNLQPGINEKDSSREIRGSLAVLQK
LLSKTTEKGYPPVPYALLVDGLSNTLKATKSLRVYAAALQLINSLFDDGLGSIHRLIVDE
DWSTSLDVAAECYRRVHEGTDGPQGIQANDESLEAVVDRELLKLVRRLDTVIKEKSRDFV
PRQTIVKFFTDVHNLLPDETAKTVLDYFQEFRCCSPSDLRWEENLNLVLKAFFSNRSRSS
DTRLRALQAMMDAYEIVNLVGDGAEQNFIPRMAKSILQNIAEEGDVLVLDAVMSLMVSVV
VSCDMELFDFVIDALRAIVVGDRLKSPISPSVLSATISPTMIDAPTPGLRQSQSPSHVVT
RGYVRMFLRLMNSHSCKSVKLYNALVGIAKTNHCETDARLTAMKLLFRLRADWANRVFVT
DDLDNISLATAMYRTDASFAKKQAEEAAQSLRLSRSDHGNQSRSSRGVSLSQSQHQERGH
PVRTPSGAKNITARYQQLWRCPDPQALPEQIPNLISPVLVSHSTATESSDESEDADEAAS
NVLQQRKPSVLNMTNWLDAVLDILQGSEWEIYSFALVHLPSQLSNHAIFRDAIPQIQELR
RIICDQIRTNGFQEPPFASGLRRADVAICLFHSLTMILSYHEHFGKGDEDEIVKTFILGI
GTWERTAKYCIHALSICCHELPLSTSKSLVQMLNQMAASITQPNVSVHILEFLACLSRLH
NVYVNFREDEYRIVFAICFRYLEYARDKRQLHRGSHNGEPNAAGMSGVATGEPTQTGPPS
EELPQYVHALAYHVILFWFLALKLQDRATHVSWIVKKLFSDPDSTGQNADEQALTSIDFM
QRVTYADVDESCEDPYFTEDRFGPIVKKQWIIGNSIVTVKQATVSGWAQIIKRQPSGTSA
YTIRETYAAPPPHQVENQVDVSREGQPTSNSILPSHVLVQLMSPVPQSFESARPIPLPDD
DAVDRAIRVFNRSSSVDSHKVGVIYIGEGQENEADILANVSGSSDYTEFLNNLGTLTKLK
GATFNTQGLDREYDSDGQYTFCWRDRVTEIVFHVTTQMPTNLERDPQCTLKKRHIGNDFV
NIIFNDSGKPFMFDTFPSQFNYVNIVITPASRASFIATRTTDRPGATSGQPFYRVQVLSK
PGFPEISPASETKMVSLNALPGFIRLLALNASVFSHVWNAREGGEHISSWSGRLREIKRL
RERYGPKTTTNLVPSPPPTSSSQNQPSESSRSSSSVRDSFSSLRRTSVATFFTSTSEQTS
HRSSTLSTAPTHDTEVGNANGVNPLVESVDFSKWA
NT seq 4788 nt NT seq  +upstreamnt  +downstreamnt
atgtccccgcagccagaagatgatcctacttctccagattcgactcgccccggcggcctg
gctacagtccttcgtagcttaacaaattccaaggcgatcaaagccccgcctcctccttcg
aacccgtcggctgccttacctcgagccgagctcatcaatgccatcccaacaaactcccat
gggctgtccaccaaccatatggatgcatttgagcagcttaaaaacggcagccccagcgag
agaatctctgccgcgaataccttaaagtacgccatcactgaatatccactcaacccgatt
ctggatatctggtatgccgcaaaggacctcatcgatccaaacaacccaccctcgacgaga
gctgctggctgggagttattgacggaatgcgcgaaacatgcatcttcgaccgatttggag
cggaaagagtactttcagactctgtccgcatctgccaaccccgaagacttccatctgcaa
ctagcagctctagtcgacctgacaagccatggtcgtgtgctggatggtttcgactacgat
ttattacctcttctgacgatttggctgcaaaacgcatacaatgcagcccgcatcgccagg
aaaaactctcattctggccgcggtgccggcggctcttccaggggcaagactgcagcgtta
ggcgaagacaagaactttgcgcagctgtttttgtttctcctggatgtcatcaagttcagc
ttcaacacggctgacgagccggccgttaccgatctaattgacaccatactcacaatctgc
atgaatacaagccaggaggatgacttgcgctcctgtatcaatgttctagatgcaattgtg
acctttggctctatcccacagagcaaactgaaggactgcgttcaagttctcagctcaatc
tactgcttggttcccaacttgcaaaagaactcgtggcacacaattgctaatctgtgcaag
tcacacaatggccaagccacggttcgaattatgcttgacatactcagaaatttgcaacct
ggcattaatgaaaaagactcgagtagagaaattcgggggagtttggcagtactccagaag
ctgctgtcgaagacgactgaaaagggctatccaccggttccgtatgcactactcgttgat
ggactgtcgaatacgctcaaggccacaaaatctttacgagtctacgctgcggccttgcaa
ctgattaattccctgttcgacgacggactcggcagcatccaccgtctcatcgtggacgaa
gattggtcgacttctcttgacgttgcggctgagtgttaccgacgtgttcatgaaggcact
gacggaccacaaggcattcaggccaatgacgaatctctggaagctgtggttgaccgcgag
ctcctgaagctcgtccgacgtctagacactgtcatcaaggagaaatctcgcgactttgta
ccccgacaaaccattgttaaattttttaccgacgttcacaatctactcccggatgaaaca
gccaagactgttctggattactttcaagaatttcggtgctgctctccatctgatttgaga
tgggaagaaaacctgaatctggtgttgaaagccttcttcagtaaccgcagtcgaagctcc
gacacacgacttagggccctccaggccatgatggacgcgtacgagattgtcaaccttgtc
ggtgatggcgcagagcagaacttcattccgaggatggccaagagcatactgcaaaacatt
gctgaagaaggtgacgttttggttctcgatgccgtcatgtcactaatggtttccgttgtt
gtgtcatgtgacatggagctttttgactttgtgattgatgctttgagagccatagtcgta
ggcgataggctcaagtctcccatatcaccttctgtcctgtcagctacaatttctccaaca
atgatagacgcacctacgcccggtctcagacagtcacagtctccttcacatgttgttaca
agaggttacgtcagaatgtttctgcgactcatgaattcacatagctgcaagagtgtgaag
ttgtacaatgccctggttggcattgctaaaacgaatcactgcgaaactgacgccaggcta
acggcgatgaagcttttgtttcgactgcgcgccgattgggccaacagagtctttgtcacg
gacgaccttgacaatatttctctggcaactgccatgtaccgcacagacgcctcatttgcc
aagaagcaggctgaagaagcagctcagtctcttcgtttgtcaagaagcgatcatggtaat
cagtcccggtcgtcgcgaggggtgtctctaagtcagtctcagcatcaagagagaggtcat
ccagtacgaacaccaagcggggccaagaacattactgcgagataccaacagctttggaga
tgcccagatccgcaggccctgccagaacaaatccctaatctcatcagtcccgtgctcgtg
tctcattcgacagcgactgaatccagcgacgagagcgaagatgcagatgaagctgcatcg
aatgtactgcagcagcgcaaaccatcagtgcttaatatgacaaactggcttgatgccgtg
ctagatatactacaaggtagtgaatgggagatctacagcttcgccctcgtccatctgccg
tcacaactcagcaatcatgccatattcagagatgcaattccacagattcaagaattacgt
cgaataatttgcgatcaaatccgaacgaatggcttccaggaacctccgttcgcatctggt
ctgcgacgggctgatgttgctatatgtctattccacagcctgacaatgatcctaagctac
cacgaacactttggcaagggtgacgaggatgaaattgtaaagacattcattctcggtatc
ggcacctgggaacgtaccgcaaaatactgcattcacgccttgtcgatatgctgtcacgag
cttccactttctactagcaaatcccttgttcaaatgctcaatcaaatggcggcaagcatc
acgcagcctaacgtgtcagttcatattctggagtttctcgcctgtctgagtcggctacac
aatgtatacgtcaactttagagaagatgagtacagaattgtattcgcaatctgcttccgt
tacctggagtatgcaagggacaaacgacaattacatcgcggcagccacaacggtgaacct
aatgcagctggcatgtctggtgttgctactggagagcccacgcagactggtcctccctcc
gaggagcttcctcaatatgtccatgctttggcgtaccatgtgattttattctggttcctg
gctctcaaacttcaggaccgcgccacgcatgtctcgtggattgtcaagaagctgttttct
gatcctgacagcactggacagaatgccgacgagcaagctcttacctcgatcgacttcatg
cagagggtcacgtatgccgatgtggacgagtcttgcgaagatccatactttactgaggat
cggttcggacccattgtgaagaagcaatggatcattggaaacagtattgtgacagtgaaa
caggcgacagtatcggggtgggcgcaaatcatcaagcgacagccttctgggacgtcggcg
tatacgatccgcgaaacctacgcagcgccaccaccacaccaggtcgagaaccaagtcgac
gtgagccgagaaggccagccaaccagcaattctattctccccagtcatgtactggttcaa
ctcatgtcacctgtgccccagagctttgagtccgcacgacctattccgttgccggatgac
gatgccgttgaccgtgcaatcagggtattcaaccgaagctccagcgtggacagtcataag
gttggcgttatatacattggggaggggcaggagaacgaggccgatattcttgccaatgtt
tctggcagcagtgactacaccgagttcctgaacaatcttggaacgctgacaaagctgaaa
ggtgcaacctttaacacgcagggattggatcgagaatacgactcagatggccaatacacg
ttttgctggcgtgacagggtgacggagattgttttccacgtcacgactcaaatgcctaca
aacctagagcgcgacccacagtgcactcttaagaagcgacatattggcaacgactttgtc
aacataattttcaacgactcaggcaaacctttcatgtttgatacgttcccgagccaattt
aattatgttaacattgtgataacgcctgcatctcgggcgtcttttatcgcaacacggacg
acggataggcctggggctacgtctggacaaccattctacagggtccaggttctgagcaag
cctggcttcccagaaatatcgccggcatcggagacgaagatggtatctttgaatgcgctg
cctggtttcatccgccttcttgctctgaatgcctcggtgttctcccatgtctggaacgct
agagagggtggcgagcacatcagttcttggagtggtcggctcagggagattaagcgtctc
cgagagagatatggaccaaagactacgacaaacttggtcccatcgccgccgccgacctcg
tcctcacagaatcaaccttctgagtcctcgcgctcaagcagtagcgtgcgggatagcttc
agcagcttgcgtcgcaccagcgtggccactttcttcaccagcaccagcgaacagacgtcc
caccggtcctcgacgctctcgacggcccctacacacgacactgaagtggggaatgcaaat
ggagtaaacccgctagtagagtctgtcgacttttcgaaatgggcttaa

DBGET integrated database retrieval system