KEGG   Metarhizium acridum: MAC_05762Help
Entry
MAC_05762         CDS       T03104                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
maw  Metarhizium acridum
Pathway
maw00250  Alanine, aspartate and glutamate metabolism
maw00410  beta-Alanine metabolism
maw00430  Taurine and hypotaurine metabolism
maw00650  Butanoate metabolism
maw01100  Metabolic pathways
maw01110  Biosynthesis of secondary metabolites
Module
maw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MAC_05762
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAC_05762
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAC_05762
   00430 Taurine and hypotaurine metabolism
    MAC_05762
Enzymes [BR:maw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MAC_05762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 19250073
NCBI-ProteinID: XP_007812102
UniProt: E9E7B4
LinkDB All DBs
Position
Unknown
AA seq 528 aa AA seqDB search
MVHLSAINKDDSGSAASIAKDTVAHLTKKARSTLKLSSEEDGFTTSVYGSRFAEQDLPKL
TMPECAMPREIAYRMIKDDLSLDNNPKLNLASFVTTYMEDEAERLMAHSLSKNFIDYEEY
PQSADIQNRCVNMIGDLFHAPSGSAIGTSSVGSSEAIMLAVLAMKRRWKIRRQAEGKSTE
RPNLIMSSAVQVCWEKATRYFEIEEKFINCTPTRFVIDPEEMVAKCDENTIGCVLILGTT
YTGDYEDVKAVNDLLIEKNINVPIHVDAASGGFVAPFVVPDLEWDFRCEKVVSINVSGHK
YGLVYPGVGWAIWRAAEYLPQDLVFNIDYLGAQQSSFTLNFSKGASQVIGQYYQLIRLGK
QGYRAIMSNLTRTADYLSNSLEKLGFIIMSKRSGEGLPLVAFRFPGPNEGGREDRHYDEF
ALAHQLRSRGWVVPAYTMAPNTNKMKMLRVVVREDFSRSRCDVLINDIKLCLGMLEEMDR
ETVKRQEEYIRTHLTSSGRAQESIHNPQHFKDEDHSLQGKTGKTHAAC
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggttcacctcagtgccatcaataaggacgacagcggcagcgctgcgagcattgccaag
gacacagttgcccacttgactaaaaaggcccgtagtactttgaaactgtcgtctgaggaa
gatggcttcaccacgagcgtctacggttctcgcttcgctgagcaggacttgcccaagctc
acaatgccagagtgtgcgatgccccgcgagattgcttatagaatgatcaaggacgatctc
agtttggataacaatcccaagctcaatctagcgtcttttgtcactacttacatggaagac
gaggctgagaggttgatggctcactccctctccaagaacttcatcgattacgaggaatat
ccccagtcagctgacattcaaaaccgatgcgtcaacatgataggcgatttgttccatgct
cccagtggcagtgccattggtacatcctctgtcggttcctccgaggccatcatgctggcc
gtgttggcgatgaagcgccgctggaagattcgccgccaggccgaaggcaaaagcactgaa
cgccccaatctcatcatgtcatccgcggtccaggtgtgctgggagaaagctacccgctat
tttgagattgaggagaagttcatcaactgcactccgacacgctttgtcattgatcctgag
gaaatggtggccaagtgtgatgagaacacaatcggctgtgttctcattttaggtactact
tacactggtgattatgaagatgtcaaggcggtgaacgacctgttgattgagaagaacatc
aatgttcctatccacgtggatgctgccagtggtggctttgtcgctccatttgtcgtgcct
gaccttgagtgggactttagatgcgagaaggtcgtctccatcaacgtctccggccataag
tatggtctggtctaccctggtgttggttgggccatttggcgagctgccgaatatctcccc
caagacctcgtcttcaacatcgactacctcggagctcagcagtcatcttttactctaaat
ttctccaagggagcatctcaagtcattggacagtattaccagcttatacgtctgggcaag
caaggctaccgcgctattatgagcaacctcacccgcacagctgactaccttagcaactcc
ctcgagaagctcggttttatcatcatgtctaagcgttccggagagggcctaccgcttgtc
gcttttcgctttccaggacctaatgaaggcggtcgcgaagaccgccactacgacgaattt
gccctggctcatcaactccgatcccgaggatgggttgttcccgcatacaccatggcgcct
aacaccaacaagatgaagatgctgcgtgttgttgttcgcgaagacttttcccgcagcaga
tgcgatgtcctgattaacgatatcaagctctgcctcggcatgttggaggagatggatcga
gagacggtcaagcgacaggaggagtacatcagaacccatttgacgtcctctggacgagct
caagaatctattcacaatcctcagcatttcaaagatgaggaccactcccttcagggcaag
actggcaagacccatgcagcttgttaa

DBGET integrated database retrieval system