KEGG   Metarhizium acridum: MAC_05928Help
Entry
MAC_05928         CDS       T03104                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
maw  Metarhizium acridum
Pathway
maw00500  Starch and sucrose metabolism
maw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MAC_05928
Enzymes [BR:maw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MAC_05928
Glycosyltransferases [BR:maw01003]
 Polysaccharide
  Storage polysaccharide
   MAC_05928
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 19250239
NCBI-ProteinID: XP_007812268
UniProt: E9E7T0
LinkDB All DBs
Position
Unknown
AA seq 703 aa AA seqDB search
MADGEPIRDVKNHLLFEVATEVAHRVGGIYSVIKSKAPVTTAEYGDRYTLIGPLNHTSAA
VEVEEMEPTNPEIAKTMQAMRDRGIGMLYGRWLIEGAPRVLLIDTKTAYGYMNEWKTDLW
NIASIPSPAGDDETNEAIVFGYLVAWFLGEFVCHEKKRAVIAHFHEWLAGVALPLTKKRR
IDVTTIFTTHATLLGRYLCAGSVDFYNNLQHFDVDAEAGKRGIYHRYCIERAATHSCDVF
TTVSHITAFESEHLLKRKPDGVLPNGLNVTKFSAVHEFQNLHQQSKEKIHDFVRGHFYGH
YDFDPDNTLYVFTAGRYEFRNKGVDMFIESLARLNHRLKNDGSKMTVVAFIIMPAQTTSL
TVEALKGQAVIKSLRDTTTMIEQSIGRRIFERSLKWHEGDAMPDEKELISGQDRVLLRRR
LFAMKRSSLPPIVTHNMVNDHEDPVLNQIRRVQLFNHPSDRVKVVFHPEFLNSANPVLPL
DYDDFVRGCHMGIFASYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDYGIY
IVDRRTKGVDDSVNQLTSYMYEFCGKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQL
ALRRAYPNSFAGDEEPEDFIPGVEQKISRPFSVPGSPRDKSGMMTPGDFASLQEGREGLS
TEDYVAWKLPAEEDPEEYPFPLTLHTKQPGGESPLPPAALNGD
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggctgacggcgagcctattcgagatgtcaagaaccacctcctcttcgaggttgctact
gaggtagcccatagagtgggtggcatctactccgtcatcaagtccaaggcgcccgtgacc
accgccgaatatggagatcgatatacgctcattgggccgctcaatcacacctctgcggcc
gtcgaggtcgaagaaatggagccgaccaacccagagattgccaagaccatgcaggccatg
agagaccgaggcatcggcatgctgtacggccgatggctcatagaaggagctcccagagtc
ttgctcattgataccaaaactgcctatggatacatgaacgagtggaagacggatctatgg
aacattgcaagcattccctcccccgccggtgacgacgagaccaacgaagccattgtgttt
gggtacttggtggcatggttcctgggagagtttgtctgtcatgaaaagaagcgagccgtc
attgctcacttccacgaatggctcgccggtgttgccctgcccctgaccaagaagcgtcgc
attgacgtcaccaccatcttcaccacccatgccactctcctcggacgatatctttgcgcc
ggctctgtcgacttttataacaacctgcagcactttgacgtcgacgctgaagctggcaag
cggggcatctaccaccgatactgcatcgagcgcgcagccacacactcttgcgacgtattt
acgaccgtgtctcacattacagcattcgagtctgagcatctgttgaagcgaaagcccgat
ggtgtgctgcccaacggtcttaacgtaaccaaattttccgccgtccacgaattccagaac
ttgcaccagcagtccaaggagaagattcacgactttgtccgcggtcacttctacggccac
tacgactttgacccggacaataccttgtacgtcttcactgctggtcgttatgagtttcga
aacaagggtgtcgacatgttcatcgagtctctggctcggttgaaccatcgcctgaagaat
gacggcagcaagatgacggttgtggctttcatcattatgccggcgcaaactacgtcgctc
accgtcgaagcgctcaagggccaggcagtcatcaagtcgctgcgggacaccacgaccatg
attgagcagagcattggacggaggatattcgagcggtccctcaagtggcacgagggagac
gcgatgcccgacgaaaaggagctcatttctggccaggaccgcgtcctgctccgacgtcgg
ctgttcgccatgaagagaagcagcctgccgcccattgtcactcacaacatggtcaatgac
cacgaagatccagtactgaaccagattcgacgtgtccagctcttcaaccatccttcagat
cgcgtcaaggtggtgttccaccctgagttcctgaactctgccaaccccgtgttgccactg
gactatgacgactttgtgcgaggctgccacatggggatttttgcttcatactacgagccg
tggggttacaccccagccgagtgcaccgtcatgggtgttcccagcatcacgaccaacttg
tcaggattcggctgctacatggaggagctgattgagaactcgagtgactacggcatctac
attgtcgatcggcgaacaaagggtgtcgatgattcagtcaaccagctgacgtcgtacatg
tacgagttttgcggcaagagtcgtcgtcaacgcatcaaccagcgaaaccgcaccgagcgg
cttagcgacctgctcgactggaagcggatgggcatggagtacgtcaaggctcgtcagctg
gcgttgcgcagggcataccccaactcctttgccggtgatgaggaacccgaggactttatt
cctggcgtggagcagaagatttcccgaccattctcggtgcccggctcaccgagggacaag
agcggaatgatgaccccaggagactttgccagtctgcaggaaggtcgcgagggtctaagc
accgaggactatgtcgcgtggaagttgcctgcagaggaggaccctgaggagtaccccttc
cctctgacattgcataccaagcagccaggtggtgaaagtcccttgccacccgctgccctg
aacggagactag

DBGET integrated database retrieval system