KEGG   Metarhizium acridum: MAC_07050Help
Entry
MAC_07050         CDS       T03104                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
maw  Metarhizium acridum
Pathway
maw00020  Citrate cycle (TCA cycle)
maw00480  Glutathione metabolism
maw01100  Metabolic pathways
maw01110  Biosynthesis of secondary metabolites
maw01130  Biosynthesis of antibiotics
maw01200  Carbon metabolism
maw01210  2-Oxocarboxylic acid metabolism
maw01230  Biosynthesis of amino acids
maw04146  Peroxisome
Module
maw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
maw_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAC_07050
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MAC_07050
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MAC_07050
Enzymes [BR:maw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MAC_07050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 19251361
NCBI-ProteinID: XP_007813390
UniProt: E9EB02
LinkDB All DBs
Position
Unknown
AA seq 458 aa AA seqDB search
MNSAARLLSSPLPLRRVPIASVRASSSRFAPSFGAVRTFSVSARNMAAARKIKVKNPVVE
LDGDEMTRIIWQTIKDKFIYPYLDIDLKYYDLGLEYRDKTNDQVTIDAAEAIKKYSVGVK
CATITPDEARVEEFKLKQMWLSPNGTIRNALGGTVFREPIVIPRIPRLVPGWEKPIIIGR
HAFGDQYRAKDLVAPGPGKLSMVYTPEGGEPQEVEVFQFKNGGGVAQAQYNTDESITGFA
HASFKLALDKGLPLYMSTKNTILKKYDGRFKDIFQELYDTQYKKDFEAKKIWYEHRLIDD
MVAQMIKSKGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGTVT
RHYREHQKGKETSTNPIASIFAWTRGLTQRGKLDNTPELVAFAESLEQACIDTVDKDGVM
TKDLALACGKNERSDYVTTNEYLNAVERRMKTILKEKL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaattccgcagctagactcctctcttccccccttccccttcgccgtgtgcccattgcc
tctgttcgcgcttcctcatcccgatttgcaccttctttcggcgccgtccgcaccttttca
gtctcagcacgcaacatggctgccgcacggaagatcaaggttaagaatccggtcgtggaa
ctcgacggtgatgagatgactcgtattatctggcagactatcaaggacaagttcatctat
ccttaccttgatatcgatctgaagtactacgatctgggtctcgagtatcgcgataagacc
aacgaccaggtcaccattgacgctgccgaggctattaagaagtactctgtcggtgtcaag
tgcgctactattacacctgatgaggctcgcgttgaggaattcaagctgaagcaaatgtgg
ctgtcaccaaacggcacaattcgaaatgctctgggcggcactgtcttccgtgagcccatc
gtcattcctcgtatccctcgtctggtccccggctgggaaaagcccatcattattggtcgc
catgcctttggtgaccaataccgcgccaaggacctcgttgctcccggaccaggcaagctg
tccatggtttacacccctgaaggcggcgagcctcaggaggtcgaggtcttccagttcaag
aacggcggcggcgttgcccaggcgcagtacaacaccgacgaatccattactggctttgct
catgcctccttcaagctcgctcttgacaagggcctgcccctctacatgagtaccaagaac
accattctgaagaagtacgatggtcgcttcaaggacatcttccaggagctctacgacacc
cagtacaagaaggactttgaggccaagaagatctggtacgaacaccgtctcattgacgac
atggttgcccaaatgattaagagcaagggcggttacatcatggctctcaagaattacgac
ggtgatgtccagtccgacattgtcgcccagggcttcggttccctcggcctcatgacctcg
gtcctcatcacccccgacggcaagacgttcgagtccgaggccgcccacggcaccgtcacc
cgccactaccgtgagcaccagaagggcaaggagacctccaccaaccccattgcctccatc
tttgcctggacccgcggcctcacccagcgcggcaagctcgacaataccccggagctggtg
gcctttgccgagagcctcgagcaggcttgcatcgacactgtcgataaagatggcgtcatg
accaaggatttggccctagcctgcggcaaaaacgagcgctccgactacgtcactaccaac
gagtacctgaatgccgttgagcgccgcatgaagaccatcctcaaggagaagctgtaa

DBGET integrated database retrieval system