KEGG   Metarhizium acridum: MAC_07466Help
Entry
MAC_07466         CDS       T03104                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
maw  Metarhizium acridum
Pathway
maw00052  Galactose metabolism
maw00500  Starch and sucrose metabolism
maw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MAC_07466
   00500 Starch and sucrose metabolism
    MAC_07466
Enzymes [BR:maw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     MAC_07466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 19251777
NCBI-ProteinID: XP_007813806
UniProt: E9EC57
LinkDB All DBs
Position
Unknown
AA seq 927 aa AA seqDB search
MKASTVIQFLFALGGTAATVKPNTRDRLRECPGYRATRDVLMGDDWFRLVEIDDESARLI
ELELAGEPCNVYGKDIPNLRVKHIVETPTRLHVIIYDAKQEAYQIPEFAFPRTRPNKVRH
RRSPLLEFEYTEYPFSFRIVRTKDATILFDSSAAGLVFEDQYIRLRTSLPVNPNLYGLGE
HSDSFRLKTNNYTRTLWNADSPSVPAGWNLYGSHPVYMEHRQKGTHGVFLLNSNGMDIVI
DSDPYSAYLEYNVLGGVLDFYFFAGESPIDVAKQYSEVSKPPALVPYAALGLHQCRWGYQ
DVFNVAEVVHNYSQAGIPLETMWTDIDYMDGRAAFSLDPERFPLKKMRQLVQHLHSRKQK
FVMMLDPGIAVKDYGPYNNGKTWPMSFLVNSSGLPYEGVVWPGRTVYPDWFAPAIQEYWN
KEFDTFFNPVTGVDIDYLWIDMNEPSNFCDFPCNDIEDVALQYPPPPPPVRAPPRELPGW
PCDFQPPGTKCDEKDIEKPLSSRKKPRATWLYFPEPMVSIPTLYFATQEAVKPEYKASFL
GFDNRDLINPPYTINNAWGMLSQKSINTSIYHNNGLTVFDTHNLYGHMMAAASRRALIAM
RSHKRPFIVTRSTFAGSGALAAHWLGDNDSSWEHYRLSIRQMLQFNSIFQVSMVGSDVCG
FNKDTTEELCARWAMLGAFQPFYRNHNAEGQIDQEFYRWTSVTQAAKKAIDIRYRLLDYF
YTALMTQSSDGTPAINPMFYIYPKDENTWGLDMQYFFGPSLLVAPVPDQGSTSVKIYFPT
DVFYDFYTHEQFFGAGKYATRTNQTITDIPLFIRGGQIIPMRARSTMTTTELRQQDFELL
VAVGTNGRAKGVLYLDDGETLHKPPHSYIEFRYKGGRLHSKIRSMDFKTGAKITKITIMG
GKRCGRGQSSCSVNLHHPLKRTLNIKI
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctagcacagttattcagttcctgtttgcccttggcgggacagctgctactgtg
aaaccgaatacacgcgatcgtctgagagaatgccctggctacagagcgacgagggacgtc
ctgatgggggacgactggttccgcttagtggagatagatgatgaatcggccagactgatc
gagttggaactcgctggcgaaccgtgcaacgtctatggcaaggatatccccaacctaagg
gtcaagcacatagttgaaactcccacgcgccttcacgtcataatctatgatgcaaaacag
gaagcctaccaaattcccgaatttgcctttccccgtacgcggccaaacaaagtgaggcat
cgcagatcgccactcttggaatttgagtacacggaatacccgttctcattcagaattgtt
cgcaccaaggacgcaacgatcctcttcgactcctctgcggcagggctggtctttgaggac
caatatattcgtctgcgaacctcgctacccgtgaatcctaacctgtacggccttggggaa
cactctgattccttccggctaaagactaacaactatacgcgtacgctgtggaatgccgat
tccccttctgttcctgctggttggaatctctacggaagtcaccccgtgtacatggagcat
cgtcaaaagggaacccacggcgtcttcttgctcaactcgaacggcatggatatcgtaatc
gacagcgatccctatagtgcctacttggagtacaatgtcctcggcggagtgctcgacttt
tacttctttgctggagaatcgcccattgacgtggccaagcagtattccgaggtctccaag
ccgccagccttggtgccctacgctgcgttgggacttcaccagtgtcgatggggctaccaa
gatgtgttcaacgttgctgaagtcgtgcacaactacagccaagctggtattcctcttgaa
accatgtggacggatattgactacatggatggccgggctgccttctccctggaccctgag
cggtttcccctgaaaaaaatgcgtcagctagtacagcatctccactcgaggaagcaaaaa
tttgtcatgatgctcgatcctggaattgctgtcaaggactatggcccttacaacaacggc
aagacgtggccaatgtccttcctcgtcaactcttcagggttaccctacgaaggtgtcgtg
tggcccggccgcaccgtctacccggactggttcgcccctgccatccaagaatactggaac
aaggaattcgataccttctttaaccctgtaacaggcgttgacattgactacctgtggata
gacatgaacgagccgtccaacttttgcgacttcccgtgcaacgacattgaagacgtagct
ctgcagtacccgcctccaccgccgcctgttcgggcgccgccgagagaattacctgggtgg
ccttgtgacttccagccaccaggcacaaaatgcgacgaaaaggatatagaaaagcccctc
tcgtcccgaaagaagccccgtgccacctggctctatttcccagagcctatggtatctata
cctacgctctacttcgccacgcaagaggcagtcaaaccagagtacaaagcctcctttcta
ggcttcgacaatcgtgatctcatcaaccccccctacaccatcaacaacgcctggggtatg
ctgtcgcaaaagagcatcaacacgagcatctatcacaacaacggcctcactgtctttgac
acgcacaatctctacggacacatgatggctgctgcctcacgcagagccctgatcgccatg
cgttctcacaagcgtcccttcatcgtcacacgttctacctttgctggctcaggagccctt
gccgcgcactggctgggtgacaatgactctagctgggagcattaccgcctgagcattcgg
caaatgctgcagttcaattccatcttccaggtgtccatggttggatccgacgtctgcggc
ttcaacaaggatactactgaggagctctgtgcgcggtgggcaatgctcggcgccttccag
ccgttttaccgtaaccacaatgccgagggacaaattgaccaggagttctaccggtggact
tccgtcacccaggcggcgaagaaggcgattgacattcggtacaggctgctcgactacttc
tacacggccttgatgacccagagttctgacgggacgccggctatcaatcccatgttctac
atttaccccaaggatgaaaacacttggggcttggacatgcagtacttctttgggccttca
ttgctcgttgcgccagtgcctgaccaagggtctacgagtgtgaaaatctacttccccacc
gacgtcttctacgacttctacacgcacgagcaatttttcggcgcaggaaagtacgccacg
agaacaaaccagaccatcaccgatatcccgctctttatccgaggtggtcaaatcattccc
atgcgtgccaggtctaccatgacgacgaccgagcttcgccagcaggatttcgaactgttg
gttgctgtcggcaccaacggcagggccaaaggagtgttgtatttggacgacggggagact
ttgcacaaaccgccgcattcgtacatcgagttccgttataagggcggcaggcttcacagc
aagatacgatcgatggatttcaagactggagcgaaaataacaaagattaccattatgggc
ggcaaaagatgcggacgtgggcagtcgtcctgctcggtcaatcttcatcacccgcttaaa
agaacactgaatataaagatttag

DBGET integrated database retrieval system