KEGG   Metarhizium acridum: MAC_08001Help
Entry
MAC_08001         CDS       T03104                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3
  KO
K03252  translation initiation factor 3 subunit C
Organism
maw  Metarhizium acridum
Pathway
maw03013  RNA transport
Brite
KEGG Orthology (KO) [BR:maw00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    MAC_08001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:maw03012]
    MAC_08001
Translation factors [BR:maw03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    MAC_08001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 19252312
NCBI-ProteinID: XP_007814341
UniProt: E9EDQ3
LinkDB All DBs
Position
Unknown
AA seq 889 aa AA seqDB search
MSRFFRGGEDSSSDSSSDEEELYSEEEQEQDLGQNDSDDSDDMDDSDMSDEQTSSDDEAG
GANRFLRDAASDSDSEEEEVRAKVKSAKDKQRDELDASIKQIENGQKNGDWTLISAEFDK
LSRQVVRMQDGGKTPKPYIRIVAELEDFMNEALAKAKVTPKKMNAIQARNLNAVKQKIKK
TSKEYQTEVNAYREDKDGFMESEDEEPEPVKPKKVARFQEETAQPEEVGDDGFATVGKGG
RTLQYTPESIFKHLRGIMETRGKKNTDRVEQIKVMEKLGEIANTPYQQIRVLLAIVSARF
DLSAGTSNVMPLEHWKAAEKELSTLLTVLENNKDYVVVENVEEWGDDEKPPALQPGEKYI
KVAGSIVSYVERLDDELVRSLQSIDPHTSEYIERLQDEGALYNIIVRGQLYYEYLRKDPA
LEIPQDSVNRIVMRRLEHVYFKVSHGLLRAQPFVFPSFLIESNALTHLQPAQVIKTFEEN
CWKAAGDKVDSVITPRSQSSDANNLVNVLCNYLFSNSDGIIRARAMLCQVYFLALHGEYY
NARDMMLMSHLQDTIPNFDVLTQILYNRTLVQVGLCAFRKGLVYDAQNTLQEICGSGRQK
ELLAQGVMMQRYSQVSPEQERLEKQRQLPFHMHINLELLECVYLTCSMLLEIPLLAQTGS
SPDVKKRVISKTYRRMLEYHERQIFTGPPENTRDHVMQASKALAAGEWKKSTTFIHSIKI
WELMPNAEDIKAMLSKQIQEEGLRTYLFTYAPFYDTLALDTVSAMFELDIAKVAAIVSKM
ISHEELAASLDQVTNNVIFRKGVELSRLQSLALTLSDKASALIETNERTLEQRTQGTSNA
FERQGGRGRGGQRGGQRSGRGGARTGGNTQRQAGGTQFTGGALGAAVRG
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgatttttccgtggtggagaggacagctccagtgacagctcctctgatgaggaa
gagctctactccgaggaggagcaagagcaggatctcggccagaatgattccgacgactcc
gacgacatggacgactctgatatgagtgacgaacagacctcaagcgacgatgaagccggt
ggtgccaaccgtttcttgagggatgccgcttcagacagcgacagtgaagaggaggaagtc
cgagccaaagtgaagagtgccaaggacaaacagcgcgatgaactcgacgcctccatcaag
cagattgagaacggccagaagaacggtgactggacattaatctctgctgaattcgacaaa
ctcagcagacaggttgtccgcatgcaagatggcggcaagacccctaagccttatatccga
atcgtcgccgagctggaggatttcatgaacgaggctttggccaaggcaaaagttacaccc
aagaagatgaacgccatccaggcccgtaacctgaatgccgtcaagcaaaagatcaagaag
accagcaaggagtaccagactgaggtgaatgcctacagagaagacaaggatggcttcatg
gagtccgaagatgaggagcctgagccagtcaagccgaagaaggttgccagatttcaggag
gagaccgcgcaacccgaagaagttggcgacgatggctttgctaccgttggcaagggtggt
cgtactctccagtataccccagagagtatcttcaaacacctgcgtggcattatggaaact
cgtggcaagaagaacaccgatcgtgttgagcagatcaaggtgatggagaagctcggcgag
attgccaacactccctaccagcagattcgggttctgctcgctatcgtgtctgccagattc
gatttgagcgctggtacatccaatgtgatgcctttggaacactggaaggctgcagaaaag
gagctgtctactcttctaactgttcttgagaacaacaaggactacgtcgttgttgagaat
gttgaggagtggggtgatgatgagaagccccctgctcttcagcctggcgagaaatatatc
aaggttgctggcagcatcgtctcatatgttgagagattggatgacgagctcgtccgatcc
ctccaaagcattgatcctcatacttctgagtacattgaacgtctccaagatgagggtgcc
ctatacaacatcatcgtccgcggccaactgtactatgagtacttgcgcaaggaccctgcc
ctcgagatcccccaagacagcgtgaatagaatcgtcatgagacgactggagcatgtctac
ttcaaggttagtcatggtctcttgagggcccagccttttgtttttccttcctttcttatc
gaaagcaacgcactgacacatctgcagcctgcccaagtcatcaagacattcgaggagaac
tgctggaaggctgctggtgacaaggtcgactctgtcatcaccccccgcagccaatccagt
gacgccaacaatttggtcaacgttctttgcaactacctgttcagcaacagtgacggcatc
atccgtgcccgagccatgttatgccaggtctacttcctcgcactgcatggcgagtactac
aatgcccgcgacatgatgctcatgtcccacttgcaggacaccattcccaacttcgacgtc
ctaacccagattctttacaaccgaactctggtccaggttggtctgtgcgccttccgcaaa
ggactcgtttatgacgcccagaacacccttcaggagatttgtggcagcggtcgccagaag
gagctgctggctcaaggtgtaatgatgcagagatacagccaagtgtcgcctgaacaggag
cgtctagagaagcagcgccagctaccgttccacatgcacattaacctcgaacttctcgag
tgtgtgtacttgacctgcagcatgcttctagagattcccctgctagcccagactggatct
tcacccgacgtcaagaaacgtgtcatcagcaagacctacagacgcatgctcgagtaccac
gagagacaaattttcaccggcccccctgagaacacgagagaccacgtcatgcaagcctcc
aaggctcttgctgctggcgagtggaagaagtcaaccactttcatccacagcatcaagatt
tgggagctgatgcccaacgccgaggatatcaaggctatgctttccaagcagatccaggaa
gaaggccttcgtacctacctgttcacatacgcccccttctacgacactctcgctctcgac
actgtaagcgccatgtttgagctggacattgccaaggtcgccgccattgtcagcaaaatg
atcagccatgaggagttggccgcttctctcgaccaggtcaccaacaatgtcatcttccgc
aagggcgtcgagcttagccgcctgcaatccttggctctcacactgtccgacaaggccagc
gcgcttatcgagaccaacgaacgaactctggagcagcggactcaaggcacatccaacgcc
ttcgagcggcaaggaggccgaggccgtggtggccagcggggcggccaacgctctgggcgc
ggtggtgcccgcaccggtggcaacactcagaggcaagctggcggcactcagtttaccggt
ggtgctttgggagctgctgttcggggttga

DBGET integrated database retrieval system