KEGG   Metarhizium acridum: MAC_08058Help
Entry
MAC_08058         CDS       T03104                                 

Definition
(RefSeq) putative oxoglutarate dehydrogenase precursor
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
maw  Metarhizium acridum
Pathway
maw00020  Citrate cycle (TCA cycle)
maw00310  Lysine degradation
maw00380  Tryptophan metabolism
maw01100  Metabolic pathways
maw01110  Biosynthesis of secondary metabolites
maw01130  Biosynthesis of antibiotics
maw01200  Carbon metabolism
Module
maw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
maw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAC_08058
  09105 Amino acid metabolism
   00310 Lysine degradation
    MAC_08058
   00380 Tryptophan metabolism
    MAC_08058
Enzymes [BR:maw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     MAC_08058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N baeRF_family12 BioY
Motif
Other DBs
NCBI-GeneID: 19252369
NCBI-ProteinID: XP_007814398
UniProt: E9EDV3
LinkDB All DBs
Position
Unknown
AA seq 1049 aa AA seqDB search
MLRNPLCRASSQVLRGARCSAALSRSSIPTVSARTSSWKLAAVRRPLAATAARSYATDAL
HSPPDPSDNFLSGGAANYIDEMYMQWKQDPKSVHVSWQVYFKNMESGDMPISQAFQPPPN
LVPNMTGGVPRLAGNLALEDGSDVTNHLKVQLLVRAYQARGHHKANIDPLGIRNTAEGFG
NIKPKELTLEHYGFTEADLDTEYTLGPGILPRFKREGRDKMTLREIVAACERIYAGSWGV
EFIHIPDREKCDWLRERLEVPQPFKYSIDEKRRVLDRLIWSSSFESFLATKYPNDKRFGL
EGCETLVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTLGAE
DEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDEKTH
RTAMGVLLHGDAAFAAQGIVYECLGFHSLPAFSTGGTIHLVVNNQIGFTTDPRFARSTAY
CTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLICYRKHGHNETDQPS
FTQPLMYKRIQQKEPQIDVYVNKLLREGTFTKEDIEEHKQWVWGMLEESFDKSKDYTPTS
KEWTTSAWNGFKSPKELATEILPHHATGVDRKTLDHVGEVIGSAPEGFQIHRNLKRILTN
RTKSVVEGKNIDFPTAEALAFGSLVTEGYHVRVSGQDVERGTFSQRHAVFHEQENEKTYT
PLQHISKDQGKFVISNSSLSEFGALGFEYGYSLQSPNALVMWEAQFGDFANNAQCIIDQF
IASGEVKWMQRTGLIMSLPHGYDGQGPEHSSGRLERYLQLSNEDPRIFPTEEKLARQHQD
CNMQIAYMTTPANLFHVLRRQMHRQFRKPLVIFFSKSLLRHPLARSNIEDFSGEDAGFQW
IIPDPEHQTGAIKAPEEIDRVILCTGQVWAALHKYRADNKIDNVAFTRIEQLNPFPWQQL
KENLDMYPNAKTIVWAQEEPLNAGAWSFTQPRIETLLNQTKYHDRKHVMYAGRNPSASVA
TGAKHLHKKEEEEFLEMAFTVKQDKLKGE
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggaatccgctctgtagagctagttcacaggtgctccgcggtgctcgatgttcc
gcagctctatcaagaagctccatcccgacagtctctgcccgaacgtcatcatggaagctc
gccgccgtccgccgtccgctggctgcgacggccgcgaggtcgtacgcaactgatgccctc
cactcgccgccggacccgagtgacaactttctgtctggaggcgctgccaactacattgat
gagatgtacatgcagtggaagcaagatcccaagagtgttcatgtgtcctggcaggtctat
ttcaagaacatggaaagtggcgacatgcccatctcccaggcttttcagccgccaccaaac
ctggttcctaacatgactgggggcgtaccccgtcttgccggcaacctagcacttgaggat
ggctctgatgtcacaaatcatctgaaagttcagctactcgtccgcgcctaccaggcccgt
ggccatcacaaggccaacattgatccccttggtatcaggaacaccgctgagggctttggt
aacatcaagcccaaggagctgaccctcgaacattatggattcaccgaagccgaccttgac
accgaatacactctgggacccggcattctgcctcgattcaaacgcgaaggccgtgataag
atgacattacgagaaattgtggccgcttgtgagaggatctacgccggatcctggggtgtc
gagttcatccacattcccgatcgcgagaagtgcgactggctgcgcgagcgtctcgaagtt
ccccagccgttcaagtactccattgacgagaagcgtcgcgtccttgatcggcttatttgg
agttccagcttcgagtctttcctggcaaccaagtatcccaatgacaagcggtttggtctc
gagggctgcgagacccttgtccccggtatgaaggctttgattgaccgcagtgtggattat
ggtgtcaaggacatcgtcattggcatgcctcaccgtggtcgtctcaacgttctcagcaac
gtcgtgcgcaaaccgaacgaatcgatcttttcagaatttgctggtacactcggcgctgag
gacgagggttccggtgacgtcaagtaccacctgggaatgaactttgagcgtcctactcct
tcgggtaaacgcgttcagctctccctggtcgcaaacccttctcacttggaagccgaagac
cccgttgtcctgggcaaaactcgagccatccagcactacaataatgacgagaagactcac
agaaccgccatgggggttctcctgcatggtgatgctgcctttgctgcccagggcattgtt
tacgaatgtttgggtttccactccctacctgccttctcaactgggggcacgatccatctt
gttgtgaacaaccaaattggcttcacaactgaccctcgattcgcccgctctacagcctac
tgcactgatattgccaaggctatcgacgcccctgtcttccacgttaatgctgatgacgtc
gaagctgtcaactttgtttgccagctggctgctgactggcgtgccgagttccagcacgat
gttgtcattgacttaatctgctaccgaaagcatggccacaacgaaacggatcagccgtcg
ttcacccaacccctcatgtacaagagaatccagcagaaggagcctcagattgacgtctat
gtcaacaagcttttacgagaaggcactttcacaaaggaagatattgaagagcacaaacaa
tgggtttggggtatgcttgaagagagctttgacaagtccaaggactatacccccacctcc
aaggagtggactacttctgcgtggaatggcttcaagtcccccaaggagctagctacggag
atcctccctcaccacgctactggagtggacaggaaaactctagaccacgttggcgaagtc
attggctctgcccctgaaggtttccagatccatcgcaacctgaagcgcattcttacgaac
cggactaagtctgttgttgaaggaaagaatattgatttccccacagcagaggctctagcg
tttggtagcttggtcactgaaggataccacgttcgtgtttctggccaagatgttgagcga
ggcacattctctcagcgtcatgccgtgttccatgaacaagagaacgagaagacatacacc
ccactgcagcacatcagtaaggaccagggcaaatttgtcatctccaactcctccctgagt
gagtttggtgctcttgggttcgagtacggttactccttgcagtcacccaatgccctggtt
atgtgggaagcgcagtttggtgactttgccaacaacgcgcagtgtatcattgaccagttt
attgcttctggagaagtgaagtggatgcagcgaactggccttattatgtctctccctcac
gggtatgatggtcaaggtcccgagcactcgtctggtcgtctggaacgttatctccagttg
tccaacgaggatcctcgtatattcccgactgaggagaagcttgcgagacagcaccaggac
tgcaacatgcagattgcctacatgacaaccccagccaacttgttccatgttctgcgccga
cagatgcaccgacagttccgaaagcctcttgtcatatttttctccaagtctttgctccgc
cacccgctcgctcgctcaaatattgaggatttcagtggcgaggatgctggcttccagtgg
attattcctgatcctgagcatcaaactggtgcaatcaaggcccctgaggagattgaccgt
gtcattttgtgcactggtcaggtctgggctgccctacataagtaccgagccgacaacaag
attgacaacgtggctttcacccgcattgagcagctgaacccattcccttggcaacagctg
aaggaaaacctcgatatgtaccctaacgccaaaaccattgtctgggcccaggaggagcct
cttaacgctggtgcttggagcttcacgcaaccccgtattgagactcttctcaaccagacc
aagtaccacgaccgaaaacatgtcatgtacgctggccgtaatccgagtgcgtctgttgcc
actggcgcgaaacatctgcacaagaaagaagaagaggagttcttggaaatggctttcacc
gtgaagcaggacaagctgaagggcgagtaa

DBGET integrated database retrieval system