KEGG   Metarhizium acridum: MAC_08393Help
Entry
MAC_08393         CDS       T03104                                 

Definition
(RefSeq) elongation factor Tu precursor
  KO
K02358  elongation factor Tu
Organism
maw  Metarhizium acridum
Brite
Translation factors [BR:maw03012]
 Eukaryotic Type
  Elongation factors
   MAC_08393
 Prokaryotic Type
   MAC_08393
Mitochondrial biogenesis [BR:maw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MAC_08393
Exosome [BR:maw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MAC_08393
  Exosomal proteins of breast cancer cells
   MAC_08393
  Exosomal proteins of colorectal cancer cells
   MAC_08393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 19252704
NCBI-ProteinID: XP_007814733
UniProt: E9EEU5
LinkDB All DBs
Position
Unknown
AA seq 445 aa AA seqDB search
MSVAFRSVAPFLRTARHGLRSGRVNPLQTAIKPQTASGILNIYRSYAVFERSKPHVNIGT
IGHVDHGKTTLSAAITKRQAEKGLANFLEYGAIDKAPEERKRGITISTAHIEYATEKRHY
SHVDCPGHADYIKNMITGAANMDGAIIVVAASDGQMPQTREHLLLARQVGVQKIVVFVNK
VDTIDDPEMLELVEMEMRELLSTYGFEGDETPVIMGSALCALNNQKPEIGNNKIDELMAA
VDEWIPTPERSLDKPFLMSVEDVFSISGRGTVVSGRVERGVLKRDEEIELVGKGKEIIKT
KVTDIETFKKSCDQSQAGDNSGLLIRGVRREDVRRGMVVCKPGTVKSHTQFLASLYVLTK
EEGGRHTGFHEHYRPQLYLRTSDESVDLTFPEGTEDAQGKMVMPGDNVEMVVTLTNPNAI
EVGQRFNIREGGKTVATGLCTRIMK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgcttttagatctgttgcgccgttcctgcggactgcgcggcacggcttgcgt
agtggccgtgttaacccccttcagacggccatcaagccccaaaccgcctcgggcattctc
aacatctaccgatcatacgccgtttttgagcgaagcaagccccatgtcaacattggcacc
attggtcacgtcgatcacggcaagaccaccctttctgctgccatcaccaagcgacaggcc
gagaagggccttgccaactttctcgagtatggtgccattgacaaggctcctgaggagcgc
aagcgtggtattaccatttcgacggcgcacatcgagtacgctaccgagaaacgtcactat
tcccacgtcgactgccctggccacgccgattatatcaagaacatgattactggcgctgcc
aacatggatggcgctattatcgttgtcgccgcctctgacggacagatgccccagactcgt
gaacacttgctccttgcccgacaggttggcgtccagaagattgtcgtcttcgtcaacaag
gtcgataccattgatgaccccgagatgttggaacttgtcgagatggaaatgcgtgagctt
ctcagcacttacggcttcgagggtgatgagacccctgtcatcatgggctctgctctttgc
gctttgaacaatcagaaacctgagattggcaacaacaagattgacgagctcatggccgct
gttgacgagtggatccctacccctgagcgtagcctggacaagcctttcctcatgtccgtc
gaggatgtcttctctatttctggccgtggtactgttgtctctggacgtgttgagcgtggt
gtcctgaagcgtgatgaggaaatcgagctcgtcggcaagggcaaggagatcatcaagacc
aaggttacagatattgaaacattcaagaagtcttgcgaccagtcgcaagctggtgacaac
tctggtctcctcatccgtggtgtccgccgcgaggatgtccgtcgcggtatggttgtctgc
aagcctggcacggtcaagtctcacactcagttcctcgcctctctctatgttcttaccaag
gaagagggtggccgccacactggtttccacgagcactaccgtccccagctctacctccga
acatctgacgagtctgtcgacctgactttccctgaaggaacggaagatgctcagggcaag
atggtcatgccaggtgacaacgtcgagatggttgtgacactgaccaaccccaatgccatc
gaggttggtcagcgattcaacattcgtgagggcggtaagactgttgctactggtctgtgt
acccgtatcatgaagtaa

DBGET integrated database retrieval system