KEGG   Metarhizium acridum: MAC_08898Help
Entry
MAC_08898         CDS       T03104                                 

Definition
(RefSeq) glutamate decarboxylase, putative
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
maw  Metarhizium acridum
Pathway
maw00250  Alanine, aspartate and glutamate metabolism
maw00410  beta-Alanine metabolism
maw00430  Taurine and hypotaurine metabolism
maw00650  Butanoate metabolism
maw01100  Metabolic pathways
maw01110  Biosynthesis of secondary metabolites
Module
maw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MAC_08898
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAC_08898
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAC_08898
   00430 Taurine and hypotaurine metabolism
    MAC_08898
Enzymes [BR:maw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MAC_08898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 19253209
NCBI-ProteinID: XP_007815238
UniProt: E9EGA0
LinkDB All DBs
Position
Unknown
AA seq 529 aa AA seqDB search
MPANGHRNGENGLLDGSSTPEKTLQRAEETDDLIDAVKSLIIPYIRAADEATHTKATGRP
QRDSNDCRRNALVEPHSPSELVECLGFSLPQNKGQGKDGLMKTIQDVLRYSVNTWDQGFL
DKLTASTNAVGVVSEMVLAALNTNVHVYRVSPSLTVVEKVTARALASYFGFKGPHAGGIT
CQGGSASNLTSLVTARGVLYPDTKLLGCQGYRFAIFTSAQGHFSVEKAAVTCGMGVSSVV
CVPVDKVGRMIPAALRSLVLESQAQGRTPLYVNATAGTTVLGAYDPLREIKAVCDEFGMW
LHVDGSWGGSVCFSAKHGHKLDGSELADSVTINPQKMLNVPMTCSFLLTNDVRRFHAANS
LRAGYLFHGQESDDDVWDLADLTLQCGRRGDSLKLALAWVYYGSHGFEQGIDHAFDMAQR
LTTLVDKSPSFELVSTNPPPCLQVCFYHAPGGRAPDNAEENTTRTREMVQKLVVRGFMVD
FAPGPKGYLFRVVVNCQTLEGTVDGLFKALYDVGQGVCGVDENKVSACG
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccaacgggcataggaatggcgaaaacggcctactcgatggctcatcgaccccg
gagaagactctgcagcgcgcagaagagacggacgacttgatcgacgctgtgaaatccctc
atcatcccctacatcagggcagcagatgaagcgacacacaccaaagcaaccggtcggcct
cagcgagattccaatgactgtcggcggaacgcactcgtcgagccgcactccccctccgag
ctcgtagagtgtctcgggttctcgttaccgcagaataagggacaaggcaaggacggcctc
atgaagactattcaggatgtcctgcggtacagtgttaatacgtgggaccaaggattcctg
gacaagctgacagccagtacaaacgccgtgggtgtggtatcggaaatggttctggctgcg
ctcaacaccaacgtccacgtctaccgtgtttccccctctctgacggtcgttgaaaaggtc
acggcgcgcgctctggcgtcttatttcggcttcaagggccctcacgccggcggaatcacc
tgccagggcggcagcgcttcgaacctgacgtcgctcgtgacggctcggggcgtcctgtac
cccgacacgaagctgctaggttgccagggataccgatttgccatcttcacaagcgcacag
ggccacttctcggtcgagaaggccgcggtgacctgcggcatgggcgtgtcgagcgtcgtc
tgcgtgccggtggacaaggtcggacgcatgattcccgcggcgctgcggtctctggtatta
gaatcccaggcccaaggcagaacgccgctgtacgtcaacgcgactgccggaaccacggtt
ctaggagcgtacgacccgctccgcgagatcaaggccgtgtgcgacgagttcggcatgtgg
ctgcacgtagacggttcctggggcggctccgtatgcttctcggccaagcatggacacaag
ctggatggctccgagctggccgactccgtcaccatcaacccgcaaaagatgctcaatgtg
cccatgacgtgctcgttcctgttgacaaacgatgtgcgtaggtttcacgccgccaactcc
ctgcgcgccgggtatctctttcacggccaggagagcgacgacgacgtttgggacctggca
gacttgacattgcagtgcgggcgaaggggcgacagcttgaagcttgctcttgcctgggtc
tactacggctcccatggcttcgagcaaggcattgatcatgcctttgacatggcacagcgc
ctgaccaccttggtggacaagtcgcctagctttgagctcgtctcgaccaacccgccgccg
tgtttgcaggtttgtttttaccatgcgcctggtggccgggccccggacaatgccgaagag
aacacgacgcgcacaagggaaatggtgcagaaattggtggttcgaggcttcatggttgac
tttgcgcctggccccaagggctacctgttcagagtcgtggtgaactgtcagacactcgag
ggaactgtggatggacttttcaaggctctatatgatgttgggcaaggtgtttgtggtgtg
gacgagaacaaggtctctgcatgtggttag

DBGET integrated database retrieval system